KEGG   Homo sapiens (human): 11164
Entry
11164             CDS       T01001                                 
Symbol
NUDT5, YSA1, YSA1H, YSAH1, hNUDT5
Name
(RefSeq) nudix hydrolase 5
  KO
K13987  ADP-sugar pyrophosphatase / 8-oxo-dGDP phosphatase / ADP-D-ribose pyrophosphorylase [EC:3.6.1.13 3.6.1.58 2.7.7.96]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    11164 (NUDT5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.96  ADP-D-ribose pyrophosphorylase
     11164 (NUDT5)
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     11164 (NUDT5)
    3.6.1.58  8-oxo-dGDP phosphatase
     11164 (NUDT5)
SSDB
Motif
Pfam: NUDIX PP1
Other DBs
NCBI-GeneID: 11164
NCBI-ProteinID: NP_054861
OMIM: 609230
HGNC: 8052
Ensembl: ENSG00000165609
Vega: OTTHUMG00000017682
Pharos: Q9UKK9(Tbio)
UniProt: Q9UKK9
Structure
LinkDB
Position
10:complement(12165330..12195891)
AA seq 219 aa
MESQEPTESSQNGKQYIISEELISEGKWVKLEKTTYMDPTGKTRTWESVKRTTRKEQTAD
GVAVIPVLQRTLHYECIVLVKQFRPPMGGYCIEFPAGLIDDGETPEAAALRELEEETGYK
GDIAECSPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQ
RLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
NT seq 660 nt   +upstreamnt  +downstreamnt
atggagagccaagaaccaacggaatcttctcagaatggcaaacagtatatcatttcagag
gagttaatttcagaaggaaaatgggtcaagcttgaaaaaacaacgtacatggatcctact
ggtaaaactagaacttgggaatcagtgaaacgtacaaccaggaaagagcagactgcggat
ggtgtcgcggtcatccccgtgctgcagagaacacttcactatgagtgtatcgttctggtg
aaacagttccgaccaccaatggggggctactgcatagagttccctgcaggtctcatagat
gatggtgaaaccccagaagcagctgctctccgggagcttgaagaagaaactggctacaaa
ggggacattgccgaatgttctccagcggtctgtatggacccaggcttgtcaaactgtact
atacacatcgtgacagtcaccattaacggagatgatgccgaaaacgcaaggccgaagcca
aagccaggggatggagagtttgtggaagtcatttctttacccaagaatgacctgctgcag
agacttgatgctctggtagctgaagaacatctcacagtggacgccagggtctattcctac
gctctagcactgaaacatgcaaatgcaaagccatttgaagtgcccttcttgaaattttaa

KEGG   Homo sapiens (human): 53343
Entry
53343             CDS       T01001                                 
Symbol
NUDT9, NUDT10
Name
(RefSeq) nudix hydrolase 9
  KO
K13988  ADP-ribose pyrophosphatase [EC:3.6.1.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    53343 (NUDT9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     53343 (NUDT9)
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-GeneID: 53343
NCBI-ProteinID: NP_076952
OMIM: 606022
HGNC: 8056
Ensembl: ENSG00000170502
Vega: OTTHUMG00000130591
Pharos: Q9BW91(Tbio)
UniProt: Q9BW91 Q96KB3
Structure
LinkDB
Position
4:87422573..87459455
AA seq 350 aa
MAGRLLGKALAAVSLSLALASVTIRSSRCRGIQAFRNSFSSSWFHLNTNVMSGSNGSKEN
SHNKARTSPYPGSKVERSQVPNEKVGWLVEWQDYKPVEYTAVSVLAGPRWADPQISESNF
SPKFNEKDGHVERKSKNGLYEIENGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKR
DSSGNKIMHPVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQ
KTSAEKREIEEKLHKLFSQDHLVIYKGYVDDPRNTDNAWMETEAVNYHDETGEIMDNLML
EAGDDAGKVKWVDINDKLKLYASHSQFIKLVAEKRDAHWSEDSEADCHAL
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggcgggacgcctcctgggaaaggctttagccgcggtgtctctctctctggccttggcc
tctgtgactatcaggtcctcgcgctgccgcggcatccaggcgttcagaaactcgttttca
tcttcttggtttcatcttaataccaacgtcatgtctggttctaatggttccaaagaaaat
tctcacaataaggctcggacgtctccttacccaggttcaaaagttgaacgaagccaggtt
cctaatgagaaagtgggctggcttgttgagtggcaagactataagcctgtggaatacact
gcagtctctgtcttggctggacccaggtgggcagatcctcagatcagtgaaagtaatttt
tctcccaagtttaacgaaaaggatgggcatgttgagagaaagagcaagaatggcctgtat
gagattgaaaatggaagaccgagaaatcctgcaggacggactggactggtgggccggggg
cttttggggcgatggggcccaaatcacgctgcagatcccattataaccagatggaaaagg
gatagcagtggaaataaaatcatgcatcctgtttctgggaagcatatcttacaatttgtt
gcaataaaaaggaaagactgtggagaatgggcaatcccaggggggatggtggatccagga
gagaagattagtgccacactgaaaagagaatttggtgaggaagctctcaactccttacag
aaaaccagtgctgagaagagagaaatagaggaaaagttgcacaaactcttcagccaagac
cacctagtgatatataagggatatgttgatgatcctcgaaacactgataatgcatggatg
gagacagaagctgtgaactaccatgacgaaacaggtgagataatggataatcttatgcta
gaagctggagatgatgctggaaaagtgaaatgggtggacatcaatgataaactgaagctt
tatgccagtcactctcaattcatcaaacttgtggctgagaaacgagatgcacactggagc
gaggactctgaagctgactgccatgcgttgtag

KEGG   Homo sapiens (human): 56985
Entry
56985             CDS       T01001                                 
Symbol
ADPRM, C17orf48, MDS006, NBLA03831
Name
(RefSeq) ADP-ribose/CDP-alcohol diphosphatase, manganese dependent
  KO
K01517  manganese-dependent ADP-ribose/CDP-alcohol diphosphatase [EC:3.6.1.13 3.6.1.16 3.6.1.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    56985 (ADPRM)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    56985 (ADPRM)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     56985 (ADPRM)
    3.6.1.16  CDP-glycerol diphosphatase
     56985 (ADPRM)
    3.6.1.53  Mn2+-dependent ADP-ribose/CDP-alcohol diphosphatase
     56985 (ADPRM)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 56985
NCBI-ProteinID: NP_064618
HGNC: 30925
Ensembl: ENSG00000170222
Vega: OTTHUMG00000130366
Pharos: Q3LIE5(Tdark)
UniProt: Q3LIE5 W0NWJ0
LinkDB
Position
17:10697594..10711558
AA seq 342 aa
MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWN
NESSMPCCVLQLGDIIDGYNAQYNASKKSLELVMDMFKRLKVPVHHTWGNHEFYNFSREY
LTHSKLNTKFLEDQIVHHPETMPSEDYYAYHFVPFPKFRFILLDAYDLSVLGVDQSSPKY
EQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTFSDTNQEKVVIVS
HLPIYPDASDNVCLAWNYRDALAVIWSHECVVCFFAGHTHDGGYSEDPFGVYHVNLEGVI
ETAPDSQAFGTVHVYPDKMMLKGRGRVPDRIMNYKKERAFHC
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggatgataaacccaatcctgaagccctaagtgacagttcagagcgtcttttctccttt
ggcgtcatcgcagatgttcaatttgcagacttagaagatggctttaatttccaaggaacc
aggcggcgatactacagacatagtcttcttcacttacagggtgccattgaagactggaat
aatgaaagcagcatgccctgttgtgtccttcagcttggagatatcatcgatggatataat
gcacagtataatgcatccaaaaagtccctagaacttgttatggacatgttcaagaggctt
aaagttccagttcatcatacatggggaaaccatgaattctataacttcagtagagagtat
ttaacacactctaaacttaacactaagtttctagaagatcagattgtacatcatcctgag
accatgccttcagaagattattatgcttatcattttgtaccattccctaaattccggttc
attttacttgatgcatatgacttgagtgtcttgggcgtggatcagtcttctccaaaatac
gagcagtgtatgaagatattgagggagcacaatccaaatacggaactgaatagtcctcaa
ggactttctgagccccagtttgtccagtttaatggaggattcagccaagaacagctaaac
tggttgaatgaagtgctaacattctctgacacaaaccaagaaaaggtggtgattgtgagc
catcttcccatttacccggacgcctctgacaatgtgtgcctggcctggaactacagagat
gccctggcagtcatttggtctcatgagtgtgtggtgtgtttctttgctggtcacacccat
gatggtggctactctgaggatccttttggtgtataccacgtcaacctagaaggagttatt
gaaacagctccagacagccaagcctttggcacagttcatgtctatcctgacaaaatgatg
ttgaaagggagaggcagagttccagatagaattatgaattacaagaaagaaagagccttc
cattgttag

DBGET integrated database retrieval system