KEGG   Homo sapiens (human): 1119
Entry
1119              CDS       T01001                                 
Symbol
CHKA, CHK, CK, CKI, EK, NEDMIMS
Name
(RefSeq) choline kinase alpha
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa05231  Choline metabolism in cancer
Module
hsa_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
hsa_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    1119 (CHKA)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    1119 (CHKA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     1119 (CHKA)
    2.7.1.82  ethanolamine kinase
     1119 (CHKA)
SSDB
Motif
Pfam: Choline_kinase APH EcKL Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 1119
NCBI-ProteinID: NP_001268
OMIM: 118491
HGNC: 1937
Ensembl: ENSG00000110721
Pharos: P35790(Tbio)
UniProt: P35790
Structure
LinkDB
Position
11:complement(68052859..68121388)
AA seq 457 aa
MKTKFCTGGEAEPSPLGLLLSCGSGSAAPAPGVGQQRDAASDLESKQLGGQQPPLALPPP
PPLPLPLPLPQPPPPQPPADEQPEPRTRRRAYLWCKEFLPGAWRGLREDEFHISVIRGGL
SNMLFQCSLPDTTATLGDEPRKVLLRLYGAILQMRSCNKEGSEQAQKENEFQGAEAMVLE
SVMFAILAERSLGPKLYGIFPQGRLEQFIPSRRLDTEELSLPDISAEIAEKMATFHGMKM
PFNKEPKWLFGTMEKYLKEVLRIKFTEESRIKKLHKLLSYNLPLELENLRSLLESTPSPV
VFCHNDCQEGNILLLEGRENSEKQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYSYEKYP
FFRANIRKYPTKKQQLHFISSYLPAFQNDFENLSTEEKSIIKEEMLLEVNRFALASHFLW
GLWSIVQAKISSIEFGYMDYAQARFDAYFHQKRKLGV
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgaaaaccaaattctgcaccgggggcgaggcggagccctcgccgctcgggctgctgctg
agctgcggtagcggcagcgcggccccggcgcccggcgtggggcagcagcgcgacgccgcc
agcgacctcgagtccaagcagctgggcggccaacagccgccgctcgcgctgccccctccg
ccgccgctgccgctgccgctgccgctgccccagcccccgccgccgcagccgcccgcagac
gagcagccggagccccggacgcggcgcagggcctatctgtggtgcaaggagttcctgccc
ggcgcctggcggggcctccgcgaggacgagttccacatcagtgtcatcagaggcggcctt
agcaacatgctgttccagtgctccctacctgacaccacagccacccttggtgatgagcct
cggaaagtgctcctgcggctgtatggagcgattttgcagatgaggtcctgtaataaagag
ggatccgaacaagctcagaaagaaaatgaatttcaaggggctgaggccatggttctggag
agcgttatgtttgccattctcgcagagaggtcacttgggccaaaactctatggcatcttt
ccccaaggccgactggagcagttcatcccgagccggcgattagatactgaagaattaagt
ttgccagatatttctgcagaaatcgccgagaaaatggctacatttcatggtatgaaaatg
ccattcaataaggaaccaaaatggctttttggcacaatggaaaagtatctaaaggaagtg
ctgagaattaaatttactgaggaatccagaattaaaaagctccacaaattgctcagttac
aatctgcccttggaactggaaaacctgagatcattgcttgaatctactccatctccagtt
gtattttgtcataatgactgtcaagaaggtaatatcttgttgctggaaggccgagagaat
tctgaaaaacagaaactgatgctcattgatttcgaatacagcagttacaattacagggga
ttcgacattggaaatcacttctgtgagtggatgtatgattatagctatgaaaaataccct
tttttcagagcaaacatccggaagtatcccaccaagaaacaacagctccattttatttcc
agttacttgcctgcattccaaaatgactttgaaaacctcagtactgaagaaaaatccatt
ataaaagaagaaatgttgcttgaagttaataggtttgcccttgcatctcatttcctctgg
ggactgtggtccattgtacaagccaagatttcatctattgaatttgggtacatggactac
gcccaagcaaggtttgatgcctatttccaccagaagaggaagcttggggtgtga

KEGG   Homo sapiens (human): 1120
Entry
1120              CDS       T01001                                 
Symbol
CHKB, CHETK, CHKL, CK, CKB, CKEKB, EK, EKB, MDCMC
Name
(RefSeq) choline kinase beta
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa05231  Choline metabolism in cancer
Module
hsa_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
hsa_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Disease
H00590  Congenital muscular dystrophies (CMD/MDC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    1120 (CHKB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    1120 (CHKB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     1120 (CHKB)
    2.7.1.82  ethanolamine kinase
     1120 (CHKB)
SSDB
Motif
Pfam: Choline_kinase APH EcKL
Other DBs
NCBI-GeneID: 1120
NCBI-ProteinID: NP_005189
OMIM: 612395
HGNC: 1938
Ensembl: ENSG00000100288
Pharos: Q9Y259(Tbio)
UniProt: Q9Y259 A0A024R4X4
Structure
LinkDB
Position
22:complement(50578963..50582849)
AA seq 395 aa
MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGA
WRRVQPEELRVYPVSGGLSNLLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLES
VMFAILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIATKMAQFHGMEMP
FTKEPHWLFGTMERYLKQIQDLPPTGLPEMNLLEMYSLKDEMGNLRKLLESTPSPVVFCH
NDIQEGNILLLSEPENADSLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTHEEWPFYKARP
TDYPTQEQQLHFIRHYLAEAKKGETLSQEEQRKLEEDLLVEVSRYALASHFFWGLWSILQ
ASMSTIEFGYLDYAQSRFQFYFQQKGQLTSVHSSS
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggcggccgaggcgacagctgtggccggaagcggggctgttggcggctgcctggccaaa
gacggcttgcagcagtctaagtgcccggacactaccccaaaacggcggcgcgcctcgtcg
ctgtcgcgtgacgccgagcgccgagcctaccaatggtgccgggagtacttgggcggggcc
tggcgccgagtgcagcccgaggagctgagggtttaccccgtgagcggaggcctcagcaac
ctgctcttccgctgctcgctcccggaccacctgcccagcgttggcgaggagccccgggag
gtgcttctgcggctgtacggagccatcttgcagggcgtggactccctggtgctagaaagc
gtgatgttcgccatacttgcggagcggtcgctggggccccagctgtacggagtcttccca
gagggccggctggaacagtacatcccaagtcggccattgaaaactcaagagcttcgagag
ccagtgttgtcagcagccattgccacgaagatggcgcaatttcatggcatggagatgcct
ttcaccaaggagccccactggctgtttgggaccatggagcggtacctaaaacagatccag
gacctgcccccaactggcctccctgagatgaacctgctggagatgtacagcctgaaggat
gagatgggcaacctcaggaagttactagagtctaccccatcgccagtcgtcttctgccac
aatgacatccaggaagggaacatcttgctgctctcagagccagaaaatgctgacagcctc
atgctggtggacttcgagtacagcagttataactataggggctttgacattgggaaccat
ttttgtgagtgggtttatgattatactcacgaggaatggcctttctacaaagcaaggccc
acagactaccccactcaagaacagcagttgcattttattcgtcattacctggcagaggca
aagaaaggtgagaccctctcccaagaggagcagagaaaactggaagaagatttgctggta
gaagtcagtcggtatgctctggcatcccatttcttctggggtctgtggtccatcctccag
gcatccatgtccaccatagaatttggttacttggactatgcccagtctcggttccagttc
tacttccagcagaaggggcagctgaccagtgtccactcctcatcctga

DBGET integrated database retrieval system