Homo sapiens (human): 113091 Help Entry 113091            CDS       T01001                                  Symbol PTH2, TIP39 Name (RefSeq) parathyroid hormone 2   KO K23143   tuberoinfundibular peptide of 39 residues Organism hsa  Homo sapiens (human) Pathway hsa04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     113091 (PTH2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hsa04052]     113091 (PTH2) Cytokines and neuropeptides [BR:hsa04052]  Neuropeptides   GPCR binding    113091 (PTH2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TIP39 DUF8050 Motif Other DBs NCBI-GeneID:  113091 NCBI-ProteinID:  NP_848544 OMIM:  608386 HGNC:  30828 Ensembl:  ENSG00000142538 CPD:  C16053 UniProt:  Q96A98 Structure PDBPDBj LinkDB All DBs Position 19:complement(49422419..49423441) Genome browser AA seq 100 aa AA seqDB search METRQVSRSPRVRLLLLLLLLLVVPWGVRTASGVALPPVGVLSLRPPGRAWADPATPRPR RSLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggagacccgccaggtgtccaggagccctcgggttcggctgctgctgctgctgctgctg ctgctggtggtgccctggggcgtccgcactgcctcgggagtcgccctgcccccggtcggg gtcctcagcctccgccccccaggacgggcctgggcggatcccgccacccccaggccgcgg aggagcctggcgctggcggacgacgcggccttccgggagcgcgcgcggttgctggccgcc ctcgagcgccgccactggctgaactcgtacatgcacaagctgctggtgttggatgcgccc tga

Homo sapiens (human): 5741 Help Entry 5741              CDS       T01001                                  Symbol PTH, FIH1, PTH1 Name (RefSeq) parathyroid hormone   KO K05261   parathyroid hormone Organism hsa  Homo sapiens (human) Pathway hsa04080   Neuroactive ligand-receptor interaction hsa04081   Hormone signaling hsa04928   Parathyroid hormone synthesis, secretion and action hsa04961   Endocrine and other factor-regulated calcium reabsorption hsa05323   Rheumatoid arthritis Network nt06318  CaSR-PTH signaling   Element N00288   PTH-PTH1R-PKA signaling pathway N00291   CaSR-PTH signaling pathway N00293   GCM2-mediated transcription Disease H01862   Hypoparathyroidism Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     5741 (PTH)    04081 Hormone signaling     5741 (PTH)  09150 Organismal Systems   09152 Endocrine system    04928 Parathyroid hormone synthesis, secretion and action     5741 (PTH)   09155 Excretory system    04961 Endocrine and other factor-regulated calcium reabsorption     5741 (PTH)  09160 Human Diseases   09163 Immune disease    05323 Rheumatoid arthritis     5741 (PTH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hsa04052]     5741 (PTH) Cytokines and neuropeptides [BR:hsa04052]  Neuropeptides   GPCR binding    5741 (PTH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Parathyroid YpoC DUF7894 Motif Other DBs NCBI-GeneID:  5741 NCBI-ProteinID:  NP_000306 OMIM:  168450 HGNC:  9606 Ensembl:  ENSG00000152266 CPD:  C16051 UniProt:  P01270 Structure PDBPDBj LinkDB All DBs Position 11:complement(13492054..13496181) Genome browser AA seq 115 aa AA seqDB search MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQ DVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgatacctgcaaaagacatggctaaagttatgattgtcatgttggcaatttgttttctt acaaaatcggatgggaaatctgttaagaagagatctgtgagtgaaatacagcttatgcat aacctgggaaaacatctgaactcgatggagagagtagaatggctgcgtaagaagctgcag gatgtgcacaattttgttgcccttggagctcctctagctcccagagatgctggttcccag aggccccgaaaaaaggaagacaatgtcttggttgagagccatgaaaaaagtcttggagag gcagacaaagctgatgtgaatgtattaactaaagctaaatcccagtga

DBGET integrated database retrieval system