KEGG   Homo sapiens (human): 11326
Entry
11326             CDS       T01001                                 
Symbol
VSIG4, CRIg, Z39IG
Name
(RefSeq) V-set and immunoglobulin domain containing 4
  KO
K19822  V-set and immunoglobulin domain-containing protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    11326 (VSIG4)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 I-set ig Ig_C17orf99 Ig_6 Izumo-Ig V-set_CD47 TMEM154
Other DBs
NCBI-GeneID: 11326
NCBI-ProteinID: NP_009199
OMIM: 300353
HGNC: 17032
Ensembl: ENSG00000155659
Pharos: Q9Y279(Tbio)
UniProt: Q9Y279
Structure
LinkDB
Position
X:complement(66021738..66040080)
AA seq 399 aa
MGILLGLLLLGHLTVDTYGRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQR
GSDPVTIFLRDSSGDHIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTP
DGNQVVRDKITELRVQKLSVSKPTVTTGSGYGFTVPQGMRISLQCQARGSPPISYIWYKQ
QTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDIVKFVVKDSSKLLKTK
TEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPVFAIILIISLCCMVVFT
MAYIMLCRKTSQQEHVYEAARAHAREANDSGETMRVAIFASGCSSDEPTSQNLGNNYSDE
PCIGQEYQIIAQINGNYARLLDTVPLDYEFLATEGKSVC
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggggatcttactgggcctgctactcctggggcacctaacagtggacacttatggccgt
cccatcctggaagtgccagagagtgtaacaggaccttggaaaggggatgtgaatcttccc
tgcacctatgaccccctgcaaggctacacccaagtcttggtgaagtggctggtacaacgt
ggctcagaccctgtcaccatctttctacgtgactcttctggagaccatatccagcaggca
aagtaccagggccgcctgcatgtgagccacaaggttccaggagatgtatccctccaattg
agcaccctggagatggatgaccggagccactacacgtgtgaagtcacctggcagactcct
gatggcaaccaagtcgtgagagataagattactgagctccgtgtccagaaactctctgtc
tccaagcccacagtgacaactggcagcggttatggcttcacggtgccccagggaatgagg
attagccttcaatgccaggctcggggttctcctcccatcagttatatttggtataagcaa
cagactaataaccaggaacccatcaaagtagcaaccctaagtaccttactcttcaagcct
gcggtgatagccgactcaggctcctatttctgcactgccaagggccaggttggctctgag
cagcacagcgacattgtgaagtttgtggtcaaagactcctcaaagctactcaagaccaag
actgaggcacctacaaccatgacataccccttgaaagcaacatctacagtgaagcagtcc
tgggactggaccactgacatggatggctaccttggagagaccagtgctgggccaggaaag
agcctgcctgtctttgccatcatcctcatcatctccttgtgctgtatggtggtttttacc
atggcctatatcatgctctgtcggaagacatcccaacaagagcatgtctacgaagcagcc
agggcacatgccagagaggccaacgactctggagaaaccatgagggtggccatcttcgca
agtggctgctccagtgatgagccaacttcccagaatctgggcaacaactactctgatgag
ccctgcataggacaggagtaccagatcatcgcccagatcaatggcaactacgcccgcctg
ctggacacagttcctctggattatgagtttctggccactgagggcaaaagtgtctgttaa

KEGG   Homo sapiens (human): 1378
Entry
1378              CDS       T01001                                 
Symbol
CR1, C3BR, C4BR, CD35, KN
Name
(RefSeq) complement C3b/C4b receptor 1 (Knops blood group)
  KO
K04011  complement component (3b/4b) receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04613  Neutrophil extracellular trap formation
hsa04640  Hematopoietic cell lineage
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05144  Malaria
hsa05152  Tuberculosis
Network
nt06513  Complement cascade
  Element
N01496  Alternative pathway of complement cascade, C3b breakdown
Disease
H00361  Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1378 (CR1)
   04610 Complement and coagulation cascades
    1378 (CR1)
   04613 Neutrophil extracellular trap formation
    1378 (CR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    1378 (CR1)
   05152 Tuberculosis
    1378 (CR1)
  09174 Infectious disease: parasitic
   05144 Malaria
    1378 (CR1)
   05140 Leishmaniasis
    1378 (CR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    1378 (CR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    1378 (CR1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    1378 (CR1)
CD molecules [BR:hsa04090]
 Proteins
  1378 (CR1)
SSDB
Motif
Pfam: Sushi Syndecan
Other DBs
NCBI-GeneID: 1378
NCBI-ProteinID: NP_000564
OMIM: 120620
HGNC: 2334
Ensembl: ENSG00000203710
Pharos: P17927(Tbio)
UniProt: P17927
Structure
LinkDB
Position
1:207496157..207641765
AA seq 2039 aa
MGASSPRSPEPVGPPAPGLPFCCGGSLLAVVVLLALPVAWGQCNAPEWLPFARPTNLTDE
FEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKG
IQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFIST
NRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCIIPNKCTP
PNVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPELPSCSRVCQPP
PDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRGAASMRCTPQGDWSPAAPTCEVKSCDD
FMGQLLNGRVLFPVNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCEQIF
CPSPPVIPNGRHTGKPLEVFPFGKTVNYTCDPHPDRGTSFDLIGESTIRCTSDPQGNGVW
SSPAPRCGILGHCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNL
VWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECILSGN
AAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGE
PSIYCTSNDDQVGIWSGPAPQCIIPNKCTPPNVENGILVSDNRSLFSLNEVVEFRCQPGF
VMKGPRRVKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGY
DLRGAASMRCTPQGDWSPAAPTCEVKSCDDFMGQLLNGRVLFPVNLQLGAKVDFVCDEGF
QLKGSSASYCVLAGMESLWNSSVPVCEQIFCPSPPVIPNGRHTGKPLEVFPFGKAVNYTC
DPHPDRGTSFDLIGESTIRCTSDPQGNGVWSSPAPRCGILGHCQAPDHFLFAKLKTQTNA
SDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITD
IQVGSRINYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIPCGLPPTIANGDFIST
NRENFHYGSVVTYRCNLGSRGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCIIPNKCTP
PNVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPELPSCSRVCQPP
PEILHGEHTPSHQDNFSPGQEVFYSCEPGYDLRGAASLHCTPQGDWSPEAPRCAVKSCDD
FLGQLPHGRVLFPLNLQLGAKVSFVCDEGFRLKGSSVSHCVLVGMRSLWNNSVPVCEHIF
CPNPPAILNGRHTGTPSGDIPYGKEISYTCDPHPDRGMTFNLIGESTIRCTSDPHGNGVW
SSPAPRCELSVRAGHCKTPEQFPFASPTIPINDFEFPVGTSLNYECRPGYFGKMFSISCL
ENLVWSSVEDNCRRKSCGPPPEPFNGMVHINTDTQFGSTVNYSCNEGFRLIGSPSTTCLV
SGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHNGTVVTYQCHTGPDGEQLFEL
VGERSIYCTSKDDQVGVWSSPPPRCISTNKCTAPEVENAIRVPGNRSFFTLTEIIRFRCQ
PGFVMVGSHTVQCQTNGRWGPKLPHCSRVCQPPPEILHGEHTLSHQDNFSPGQEVFYSCE
PSYDLRGAASLHCTPQGDWSPEAPRCTVKSCDDFLGQLPHGRVLLPLNLQLGAKVSFVCD
EGFRLKGRSASHCVLAGMKALWNSSVPVCEQIFCPNPPAILNGRHTGTPFGDIPYGKEIS
YACDTHPDRGMTFNLIGESSIRCTSDPQGNGVWSSPAPRCELSVPAACPHPPKIQNGHYI
GGHVSLYLPGMTISYICDPGYLLVGKGFIFCTDQGIWSQLDHYCKEVNCSFPLFMNGISK
ELEMKKVYHYGDYVTLKCEDGYTLEGSPWSQCQADDRWDPPLAKCTSRTHDALIVGTLSG
TIFFILLIIFLSWIILKHRKGNNAHENPKEVAIHLHSQGGSSVHPRTLQTNEENSRVLP
NT seq 6120 nt   +upstreamnt  +downstreamnt
atgggggcctcttctccaagaagcccggagcctgtcgggccgccggcgcccggtctcccc
ttctgctgcggaggatccctgctggcggttgtggtgctgcttgcgctgccggtggcctgg
ggtcaatgcaatgccccagaatggcttccatttgccaggcctaccaacctaactgatgaa
tttgagtttcccattgggacatatctgaactatgaatgccgccctggttattccggaaga
ccgttttctatcatctgcctaaaaaactcagtctggactggtgctaaggacaggtgcaga
cgtaaatcatgtcgtaatcctccagatcctgtgaatggcatggtgcatgtgatcaaaggc
atccagttcggatcccaaattaaatattcttgtactaaaggataccgactcattggttcc
tcgtctgccacatgcatcatctcaggtgatactgtcatttgggataatgaaacacctatt
tgtgacagaattccttgtgggctaccccccaccatcaccaatggagatttcattagcacc
aacagagagaattttcactatggatcagtggtgacctaccgctgcaatcctggaagcgga
gggagaaaggtgtttgagcttgtgggtgagccctccatatactgcaccagcaatgacgat
caagtgggcatctggagcggccccgcccctcagtgcattatacctaacaaatgcacgcct
ccaaatgtggaaaatggaatattggtatctgacaacagaagcttattttccttaaatgaa
gttgtggagtttaggtgtcagcctggctttgtcatgaaaggaccccgccgtgtgaagtgc
caggccctgaacaaatgggagccggagctaccaagctgctccagggtatgtcagccacct
ccagatgtcctgcatgctgagcgtacccaaagggacaaggacaacttttcacctgggcag
gaagtgttctacagctgtgagcccggctacgacctcagaggggctgcgtctatgcgctgc
acaccccagggagactggagccctgcagcccccacatgtgaagtgaaatcctgtgatgac
ttcatgggccaacttcttaatggccgtgtgctatttccagtaaatctccagcttggagca
aaagtggattttgtttgtgatgaaggatttcaattaaaaggcagctctgctagttactgt
gtcttggctggaatggaaagcctttggaatagcagtgttccagtgtgtgaacaaatcttt
tgtccaagtcctccagttattcctaatgggagacacacaggaaaacctctggaagtcttt
ccctttgggaaaacagtaaattacacatgcgacccccacccagacagagggacgagcttc
gacctcattggagagagcaccatccgctgcacaagtgaccctcaagggaatggggtttgg
agcagccctgcccctcgctgtggaattctgggtcactgtcaagccccagatcattttctg
tttgccaagttgaaaacccaaaccaatgcatctgactttcccattgggacatctttaaag
tacgaatgccgtcctgagtactacgggaggccattctctatcacatgtctagataacctg
gtctggtcaagtcccaaagatgtctgtaaacgtaaatcatgtaaaactcctccagatcca
gtgaatggcatggtgcatgtgatcacagacatccaggttggatccagaatcaactattct
tgtactacagggcaccgactcattggtcactcatctgctgaatgtatcctctcgggcaat
gctgcccattggagcacgaagccgccaatttgtcaacgaattccttgtgggctacccccc
accatcgccaatggagatttcattagcaccaacagagagaattttcactatggatcagtg
gtgacctaccgctgcaatcctggaagcggagggagaaaggtgtttgagcttgtgggtgag
ccctccatatactgcaccagcaatgacgatcaagtgggcatctggagcggcccggcccct
cagtgcattatacctaacaaatgcacgcctccaaatgtggaaaatggaatattggtatct
gacaacagaagcttattttccttaaatgaagttgtggagtttaggtgtcagcctggcttt
gtcatgaaaggaccccgccgtgtgaagtgccaggccctgaacaaatgggagccggagcta
ccaagctgctccagggtatgtcagccacctccagatgtcctgcatgctgagcgtacccaa
agggacaaggacaacttttcacccgggcaggaagtgttctacagctgtgagcccggctat
gacctcagaggggctgcgtctatgcgctgcacaccccagggagactggagccctgcagcc
cccacatgtgaagtgaaatcctgtgatgacttcatgggccaacttcttaatggccgtgtg
ctatttccagtaaatctccagcttggagcaaaagtggattttgtttgtgatgaaggattt
caattaaaaggcagctctgctagttattgtgtcttggctggaatggaaagcctttggaat
agcagtgttccagtgtgtgaacaaatcttttgtccaagtcctccagttattcctaatggg
agacacacaggaaaacctctggaagtctttccctttggaaaagcagtaaattacacatgc
gacccccacccagacagagggacgagcttcgacctcattggagagagcaccatccgctgc
acaagtgaccctcaagggaatggggtttggagcagccctgcccctcgctgtggaattctg
ggtcactgtcaagccccagatcattttctgtttgccaagttgaaaacccaaaccaatgca
tctgactttcccattgggacatctttaaagtacgaatgccgtcctgagtactacgggagg
ccattctctatcacatgtctagataacctggtctggtcaagtcccaaagatgtctgtaaa
cgtaaatcatgtaaaactcctccagatccagtgaatggcatggtgcatgtgatcacagac
atccaggttggatccagaatcaactattcttgtactacagggcaccgactcattggtcac
tcatctgctgaatgtatcctctcaggcaatactgcccattggagcacgaagccgccaatt
tgtcaacgaattccttgtgggctacccccaaccatcgccaatggagatttcattagcacc
aacagagagaattttcactatggatcagtggtgacctaccgctgcaatcttggaagcaga
gggagaaaggtgtttgagcttgtgggtgagccctccatatactgcaccagcaatgacgat
caagtgggcatctggagcggccccgcccctcagtgcattatacctaacaaatgcacgcct
ccaaatgtggaaaatggaatattggtatctgacaacagaagcttattttccttaaatgaa
gttgtggagtttaggtgtcagcctggctttgtcatgaaaggaccccgccgtgtgaagtgc
caggccctgaacaaatgggagccagagttaccaagctgctccagggtgtgtcagccgcct
ccagaaatcctgcatggtgagcataccccaagccatcaggacaacttttcacctgggcag
gaagtgttctacagctgtgagcctggctatgacctcagaggggctgcgtctctgcactgc
acaccccagggagactggagccctgaagccccgagatgtgcagtgaaatcctgtgatgac
ttcttgggtcaactccctcatggccgtgtgctatttccacttaatctccagcttggggca
aaggtgtcctttgtctgtgatgaagggtttcgcttaaagggcagttccgttagtcattgt
gtcttggttggaatgagaagcctttggaataacagtgttcctgtgtgtgaacatatcttt
tgtccaaatcctccagctatccttaatgggagacacacaggaactccctctggagatatt
ccctatggaaaagaaatatcttacacatgtgacccccacccagacagagggatgaccttc
aacctcattggggagagcaccatccgctgcacaagtgaccctcatgggaatggggtttgg
agcagccctgcccctcgctgtgaactttctgttcgtgctggtcactgtaaaaccccagag
cagtttccatttgccagtcctacgatcccaattaatgactttgagtttccagtcgggaca
tctttgaattatgaatgccgtcctgggtattttgggaaaatgttctctatctcctgccta
gaaaacttggtctggtcaagtgttgaagacaactgtagacgaaaatcatgtggacctcca
ccagaacccttcaatggaatggtgcatataaacacagatacacagtttggatcaacagtt
aattattcttgtaatgaagggtttcgactcattggttccccatctactacttgtctcgtc
tcaggcaataatgtcacatgggataagaaggcacctatttgtgagatcatatcttgtgag
ccacctccaaccatatccaatggagacttctacagcaacaatagaacatcttttcacaat
ggaacggtggtaacttaccagtgccacactggaccagatggagaacagctgtttgagctt
gtgggagaacggtcaatatattgcaccagcaaagatgatcaagttggtgtttggagcagc
cctccccctcggtgtatttctactaataaatgcacagctccagaagttgaaaatgcaatt
agagtaccaggaaacaggagtttctttaccctcactgagatcatcagatttagatgtcag
cccgggtttgtcatggtagggtcccacactgtgcagtgccagaccaatggcagatggggg
cccaagctgccacactgctccagggtgtgtcagccgcctccagaaatcctgcatggtgag
cataccctaagccatcaggacaacttttcacctgggcaggaagtgttctacagctgtgag
cccagctatgacctcagaggggctgcgtctctgcactgcacgccccagggagactggagc
cctgaagcccctagatgtacagtgaaatcctgtgatgacttcctgggccaactccctcat
ggccgtgtgctacttccacttaatctccagcttggggcaaaggtgtcctttgtttgcgat
gaagggttccgattaaaaggcaggtctgctagtcattgtgtcttggctggaatgaaagcc
ctttggaatagcagtgttccagtgtgtgaacaaatcttttgtccaaatcctccagctatc
cttaatgggagacacacaggaactccctttggagatattccctatggaaaagaaatatct
tacgcatgcgacacccacccagacagagggatgaccttcaacctcattggggagagctcc
atccgctgcacaagtgaccctcaagggaatggggtttggagcagccctgcccctcgctgt
gaactttctgttcctgctgcctgcccacatccacccaagatccaaaacgggcattacatt
ggaggacacgtatctctatatcttcctgggatgacaatcagctacatttgtgaccccggc
tacctgttagtgggaaagggcttcattttctgtacagaccagggaatctggagccaattg
gatcattattgcaaagaagtaaattgtagcttcccactgtttatgaatggaatctcgaag
gagttagaaatgaaaaaagtatatcactatggagattatgtgactttgaagtgtgaagat
gggtatactctggaaggcagtccctggagccagtgccaggcggatgacagatgggaccct
cctctggccaaatgtacctctcgtacacatgatgctctcatagttggcactttatctggt
acgatcttctttattttactcatcattttcctctcttggataattctaaagcacagaaaa
ggcaataatgcacatgaaaaccctaaagaagtggctatccatttacattctcaaggaggc
agcagcgttcatccccgaactctgcaaacaaatgaagaaaatagcagggtccttccttga

KEGG   Homo sapiens (human): 1380
Entry
1380              CDS       T01001                                 
Symbol
CR2, C3DR, CD21, CR, CVID7, SLEB9
Name
(RefSeq) complement C3d receptor 2
  KO
K04012  complement receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04640  Hematopoietic cell lineage
hsa04662  B cell receptor signaling pathway
hsa05169  Epstein-Barr virus infection
Network
nt06140  Transcription (viruses)
nt06165  Epstein-Barr virus (EBV)
  Element
N00225  EBV EBNA2 to RBP-Jk-mediated transcription
Disease
H00080  Systemic lupus erythematosus
H00088  Common variable immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1380 (CR2)
   04610 Complement and coagulation cascades
    1380 (CR2)
   04662 B cell receptor signaling pathway
    1380 (CR2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    1380 (CR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    1380 (CR2)
CD molecules [BR:hsa04090]
 Proteins
  1380 (CR2)
SSDB
Motif
Pfam: Sushi UL45
Other DBs
NCBI-GeneID: 1380
NCBI-ProteinID: NP_001868
OMIM: 120650
HGNC: 2336
Ensembl: ENSG00000117322
Pharos: P20023(Tbio)
UniProt: P20023
Structure
LinkDB
Position
1:207454328..207489892
AA seq 1033 aa
MGAAGLLGVFLALVAPGVLGISCGSPPPILNGRISYYSTPIAVGTVIRYSCSGTFRLIGE
KSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKT
NFSMNGNKSVWCQANNMWGPTRLPTCVSVFPLECPALPMIHNGHHTSENVGSIAPGLSVT
YSCESGYLLVGEKIINCLSSGKWSAVPPTCEEARCKSLGRFPNGKVKEPPILRVGVTANF
FCDEGYRLQGPPSSRCVIAGQGVAWTKMPVCEEIFCPSPPPILNGRHIGNSLANVSYGSI
VTYTCDPDPEEGVNFILIGESTLRCTVDSQKTGTWSGPAPRCELSTSAVQCPHPQILRGR
MVSGQKDRYTYNDTVIFACMFGFTLKGSKQIRCNAQGTWEPSAPVCEKECQAPPNILNGQ
KEDRHMVRFDPGTSIKYSCNPGYVLVGEESIQCTSEGVWTPPVPQCKVAACEATGRQLLT
KPQHQFVRPDVNSSCGEGYKLSGSVYQECQGTIPWFMEIRLCKEITCPPPPVIYNGAHTG
SSLEDFPYGTTVTYTCNPGPERGVEFSLIGESTIRCTSNDQERGTWSGPAPLCKLSLLAV
QCSHVHIANGYKISGKEAPYFYNDTVTFKCYSGFTLKGSSQIRCKADNTWDPEIPVCEKE
TCQHVRQSLQELPAGSRVELVNTSCQDGYQLTGHAYQMCQDAENGIWFKKIPLCKVIHCH
PPPVIVNGKHTGMMAENFLYGNEVSYECDQGFYLLGEKKLQCRSDSKGHGSWSGPSPQCL
RSPPVTRCPNPEVKHGYKLNKTHSAYSHNDIVYVDCNPGFIMNGSRVIRCHTDNTWVPGV
PTCIKKAFIGCPPPPKTPNGNHTGGNIARFSPGMSILYSCDQGYLLVGEALLLCTHEGTW
SQPAPHCKEVNCSSPADMDGIQKGLEPRKMYQYGAVVTLECEDGYMLEGSPQSQCQSDHQ
WNPPLAVCRSRSLAPVLCGIAAGLILLTFLIVITLYVISKHRARNYYTDTSQKEAFHLEA
REVYSVDPYNPAS
NT seq 3102 nt   +upstreamnt  +downstreamnt
atgggcgccgcgggcctgctcggggttttcttggctctcgtcgcaccgggggtcctcggg
atttcttgtggctctcctccgcctatcctaaatggccggattagttattattctaccccc
attgctgttggtaccgtgataaggtacagttgttcaggtaccttccgcctcattggagaa
aaaagtctattatgcataactaaagacaaagtggatggaacctgggataaacctgctcct
aaatgtgaatatttcaataaatattcttcttgccctgagcccatagtaccaggaggatac
aaaattagaggctctacaccctacagacatggtgattctgtgacatttgcctgtaaaacc
aacttctccatgaacggaaacaagtctgtttggtgtcaagcaaataatatgtgggggccg
acacgactaccaacctgtgtaagtgttttccctctcgagtgtccagcacttcctatgatc
cacaatggacatcacacaagtgagaatgttggctccattgctccaggattgtctgtgact
tacagctgtgaatctggttacttgcttgttggagaaaagatcattaactgtttgtcttcg
ggaaaatggagtgctgtcccccccacatgtgaagaggcacgctgtaaatctctaggacga
tttcccaatgggaaggtaaaggagcctccaattctccgggttggtgtaactgcaaacttt
ttctgtgatgaagggtatcgactgcaaggcccaccttctagtcggtgtgtaattgctgga
cagggagttgcttggaccaaaatgccagtatgtgaagaaattttttgcccatcacctccc
cctattctcaatggaagacatataggcaactcactagcaaatgtctcatatggaagcata
gtcacttacacttgtgacccggacccagaggaaggagtgaacttcatccttattggagag
agcactctccgttgtacagttgatagtcagaagactgggacctggagtggccctgcccca
cgctgtgaactttctacttctgcggttcagtgtccacatccccagatcctaagaggccga
atggtatctgggcagaaagatcgatatacctataacgacactgtgatatttgcttgcatg
tttggcttcaccttgaagggcagcaagcaaatccgatgcaatgcccaaggcacatgggag
ccatctgcaccagtctgtgaaaaggaatgccaggcccctcctaacatcctcaatgggcaa
aaggaagatagacacatggtccgctttgaccctggaacatctataaaatatagctgtaac
cctggctatgtgctggtgggagaagaatccatacagtgtacctctgagggggtgtggaca
ccccctgtaccccaatgcaaagtggcagcgtgtgaagctacaggaaggcaactcttgaca
aaaccccagcaccaatttgttagaccagatgtcaactcttcttgtggtgaagggtacaag
ttaagtgggagtgtttatcaggagtgtcaaggcacaattccttggtttatggagattcgt
ctttgtaaagaaatcacctgcccaccaccccctgttatctacaatggggcacacaccggg
agttccttagaagattttccatatggaaccacggtcacttacacatgtaaccctgggcca
gaaagaggagtggaattcagcctcattggagagagcaccatccgttgtacaagcaatgat
caagaaagaggcacctggagtggccctgctcccctgtgtaaactttccctccttgctgtc
cagtgctcacatgtccatattgcaaatggatacaagatatctggcaaggaagccccatat
ttctacaatgacactgtgacattcaagtgttatagtggatttactttgaagggcagtagt
cagattcgttgcaaagctgataacacctgggatcctgaaataccagtttgtgaaaaagaa
acatgccagcatgtgagacagagtcttcaagaacttccagctggttcacgtgtggagcta
gttaatacgtcctgccaagatgggtaccagttgactggacatgcttatcagatgtgtcaa
gatgctgaaaatggaatttggttcaaaaagattccactttgtaaagttattcactgtcac
cctccaccagtgattgtcaatgggaagcacacaggcatgatggcagaaaactttctatat
ggaaatgaagtctcttatgaatgtgaccaaggattctatctcctgggagagaaaaaattg
cagtgcagaagtgattctaaaggacatggatcttggagcgggccttccccacagtgctta
cgatctcctcctgtgactcgctgccctaatccagaagtcaaacatgggtacaagctcaat
aaaacacattctgcatattcccacaatgacatagtgtatgttgactgcaatcctggcttc
atcatgaatggtagtcgcgtgattaggtgtcatactgataacacatgggtgccaggtgtg
ccaacttgtatcaaaaaagccttcatagggtgtccacctccgcctaagacccctaacggg
aaccatactggtggaaacatagctcgattttctcctggaatgtcaatcctgtacagctgt
gaccaaggctacctgctggtgggagaggcactccttctttgcacacatgagggaacctgg
agccaacctgcccctcattgtaaagaggtaaactgtagctcaccagcagatatggatgga
atccagaaagggctggaaccaaggaaaatgtatcagtatggagctgttgtaactctggag
tgtgaagatgggtatatgctggaaggcagtccccagagccagtgccaatcggatcaccaa
tggaaccctcccctggcggtttgcagatcccgttcacttgctcctgtcctttgtggtatt
gctgcaggtttgatacttcttaccttcttgattgtcattaccttatacgtgatatcaaaa
cacagagcacgcaattattatacagatacaagccagaaagaagcttttcatttagaagca
cgagaagtatattctgttgatccatacaacccagccagctga

KEGG   Homo sapiens (human): 3684
Entry
3684              CDS       T01001                                 
Symbol
ITGAM, CD11B, CR3A, MAC-1, MAC1A, MO1A, SLEB6
Name
(RefSeq) integrin subunit alpha M
  KO
K06461  integrin alpha M
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04610  Complement and coagulation cascades
hsa04613  Neutrophil extracellular trap formation
hsa04640  Hematopoietic cell lineage
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05146  Amoebiasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00112  AML1-ETO fusion to PU.1-mediated transcription
Drug target
Fuzapladib sodium hydrate: D11919
Rovelizumab: D08993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    3684 (ITGAM)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3684 (ITGAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3684 (ITGAM)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3684 (ITGAM)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3684 (ITGAM)
   04610 Complement and coagulation cascades
    3684 (ITGAM)
   04613 Neutrophil extracellular trap formation
    3684 (ITGAM)
   04670 Leukocyte transendothelial migration
    3684 (ITGAM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3684 (ITGAM)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    3684 (ITGAM)
  09171 Infectious disease: bacterial
   05133 Pertussis
    3684 (ITGAM)
   05134 Legionellosis
    3684 (ITGAM)
   05150 Staphylococcus aureus infection
    3684 (ITGAM)
   05152 Tuberculosis
    3684 (ITGAM)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3684 (ITGAM)
   05140 Leishmaniasis
    3684 (ITGAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3684 (ITGAM)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3684 (ITGAM)
   04515 Cell adhesion molecules [BR:hsa04515]
    3684 (ITGAM)
   04090 CD molecules [BR:hsa04090]
    3684 (ITGAM)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3684 (ITGAM)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3684 (ITGAM)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3684 (ITGAM)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3684 (ITGAM)
CD molecules [BR:hsa04090]
 Proteins
  3684 (ITGAM)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   3684 (ITGAM)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 Integrin_alpha FG-GAP_3 FG-GAP_2
Other DBs
NCBI-GeneID: 3684
NCBI-ProteinID: NP_000623
OMIM: 120980
HGNC: 6149
Ensembl: ENSG00000169896
Pharos: P11215(Tbio)
UniProt: P11215
Structure
LinkDB
Position
16:31259975..31332877
AA seq 1152 aa
MALRVLLLTALTLCHGFNLDTENAMTFQENARGFGQSVVQLQGSRVVVGAPQEIVAANQR
GSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVK
GLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQL
KKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFN
ITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQEL
NTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEMSQEGFSAAIT
SNGPLLSTVGSYDWAGGVFLYTSKEKSTFINMTRVDSDMNDAYLGYAAAIILRNRVQSLV
LGAPRYQHIGLVAMFRQNTGMWESNANVKGTQIGAYFGASLCSVDVDSNGSTDLVLIGAP
HYYEQTRGGQVSVCPLPRGRARWQCDAVLYGEQGQPWGRFGAALTVLGDVNGDKLTDVAI
GAPGEEDNRGAVYLFHGTSGSGISPSHSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVD
LTVGAQGHVLLLRSQPVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKS
TRDRLREGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRRQTQVLGLTQTCETLKLQLPN
CIEDPVSPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNCGNDNICQDDL
SITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLDLSYRKVSTLQNQRSQ
RSWRLACESASSTEVSGALKSTSCSINHPIFPENSEVTFNITFDVDSKASLGNKLLLKAN
VTSENNMPRTNKTEFQLELPVKYAVYMVVTSHGVSTKYLNFTASENTSRVMQHQYQVSNL
GQRSLPISLVFLVPVRLNQTVIWDRPQVTFSENLSSTCHTKERLPSHSDFLAELRKAPVV
NCSIAVCQRIQCDIPFFGIQEEFNATLKGNLSFDWYIKTSHNHLLIVSTAEILFNDSVFT
LLPGQGAFVRSQTETKVEPFEVPNPLPLIVGSSVGGLLLLALITAALYKLGFFKRQYKDM
MSEGGPPGAEPQ
NT seq 3459 nt   +upstreamnt  +downstreamnt
atggctctcagagtccttctgttaacagccttgaccttatgtcatgggttcaacttggac
actgaaaacgcaatgaccttccaagagaacgcaaggggcttcgggcagagcgtggtccag
cttcagggatccagggtggtggttggagccccccaggagatagtggctgccaaccaaagg
ggcagcctctaccagtgcgactacagcacaggctcatgcgagcccatccgcctgcaggtc
cccgtggaggccgtgaacatgtccctgggcctgtccctggcagccaccaccagcccccct
cagctgctggcctgtggtcccaccgtgcaccagacttgcagtgagaacacgtatgtgaaa
gggctctgcttcctgtttggatccaacctacggcagcagccccagaagttcccagaggcc
ctccgagggtgtcctcaagaggatagtgacattgccttcttgattgatggctctggtagc
atcatcccacatgactttcggcggatgaaggagtttgtctcaactgtgatggagcaatta
aaaaagtccaaaaccttgttctctttgatgcagtactctgaagaattccggattcacttt
accttcaaagagttccagaacaaccctaacccaagatcactggtgaagccaataacgcag
ctgcttgggcggacacacacggccacgggcatccgcaaagtggtacgagagctgtttaac
atcaccaacggagcccgaaagaatgcctttaagatcctagttgtcatcacggatggagaa
aagtttggcgatcccttgggatatgaggatgtcatccctgaggcagacagagagggagtc
attcgctacgtcattggggtgggagatgccttccgcagtgagaaatcccgccaagagctt
aataccatcgcatccaagccgcctcgtgatcacgtgttccaggtgaataactttgaggct
ctgaagaccattcagaaccagcttcgggagaagatctttgcgatcgagggtactcagaca
ggaagtagcagctcctttgagcatgagatgtctcaggaaggcttcagcgctgccatcacc
tctaatggccccttgctgagcactgtggggagctatgactgggctggtggagtctttcta
tatacatcaaaggagaaaagcaccttcatcaacatgaccagagtggattcagacatgaat
gatgcttacttgggttatgctgccgccatcatcttacggaaccgggtgcaaagcctggtt
ctgggggcacctcgatatcagcacatcggcctggtagcgatgttcaggcagaacactggc
atgtgggagtccaacgctaatgtcaagggcacccagatcggcgcctacttcggggcctcc
ctctgctccgtggacgtggacagcaacggcagcaccgacctggtcctcatcggggccccc
cattactacgagcagacccgagggggccaggtgtccgtgtgccccttgcccagggggagg
gctcggtggcagtgtgatgctgttctctacggggagcagggccaaccctggggccgcttt
ggggcagccctaacagtgctgggggacgtaaatggggacaagctgacggacgtggccatt
ggggccccaggagaggaggacaaccggggtgctgtttacctgtttcacggaacctcagga
tctggcatcagcccctcccatagccagcggatagcaggctccaagctctctcccaggctc
cagtattttggtcagtcactgagtgggggccaggacctcacaatggatggactggtagac
ctgactgtaggagcccaggggcacgtgctgctgctcaggtcccagccagtactgagagtc
aaggcaatcatggagttcaatcccagggaagtggcaaggaatgtatttgagtgtaatgat
caggtggtgaaaggcaaggaagccggagaggtcagagtctgcctccatgtccagaagagc
acacgggatcggctaagagaaggacagatccagagtgttgtgacttatgacctggctctg
gactccggccgcccacattcccgcgccgtcttcaatgagacaaagaacagcacacgcaga
cagacacaggtcttggggctgacccagacttgtgagaccctgaaactacagttgccgaat
tgcatcgaggacccagtgagccccattgtgctgcgcctgaacttctctctggtgggaacg
ccattgtctgctttcgggaacctccggccagtgctggcggaggatgctcagagactcttc
acagccttgtttccctttgagaagaattgtggcaatgacaacatctgccaggatgacctc
agcatcaccttcagtttcatgagcctggactgcctcgtggtgggtgggccccgggagttc
aacgtgacagtgactgtgagaaatgatggtgaggactcctacaggacacaggtcaccttc
ttcttcccgcttgacctgtcctaccggaaggtgtccacgctccagaaccagcgctcacag
cgatcctggcgcctggcctgtgagtctgcctcctccaccgaagtgtctggggccttgaag
agcaccagctgcagcataaaccaccccatcttcccggaaaactcagaggtcacctttaat
atcacgtttgatgtagactctaaggcttcccttggaaacaaactgctcctcaaggccaat
gtgaccagtgagaacaacatgcccagaaccaacaaaaccgaattccaactggagctgccg
gtgaaatatgctgtctacatggtggtcaccagccatggggtctccactaaatatctcaac
ttcacggcctcagagaataccagtcgggtcatgcagcatcaatatcaggtcagcaacctg
gggcagaggagcctccccatcagcctggtgttcttggtgcccgtccggctgaaccagact
gtcatatgggaccgcccccaggtcaccttctccgagaacctctcgagtacgtgccacacc
aaggagcgcttgccctctcactccgactttctggctgagcttcggaaggcccccgtggtg
aactgctccatcgctgtctgccagagaatccagtgtgacatcccgttctttggcatccag
gaagaattcaatgctaccctcaaaggcaacctctcgtttgactggtacatcaagacctcg
cataaccacctcctgatcgtgagcacagctgagatcttgtttaacgattccgtgttcacc
ctgctgccgggacagggggcgtttgtgaggtcccagacggagaccaaagtggagccgttc
gaggtccccaaccccctgccgctcatcgtgggcagctctgtcgggggactgctgctcctg
gccctcatcaccgccgcgctgtacaagctcggcttcttcaagcggcaatacaaggacatg
atgagtgaagggggtcccccgggggccgaaccccagtag

KEGG   Homo sapiens (human): 3689
Entry
3689              CDS       T01001                                 
Symbol
ITGB2, CD18, LAD, LCAMB, LFA-1, MAC-1, MF17, MFI7
Name
(RefSeq) integrin subunit beta 2
  KO
K06464  integrin beta 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04145  Phagosome
hsa04390  Hippo signaling pathway
hsa04514  Cell adhesion molecules
hsa04610  Complement and coagulation cascades
hsa04613  Neutrophil extracellular trap formation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05144  Malaria
hsa05146  Amoebiasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05166  Human T-cell leukemia virus 1 infection
hsa05323  Rheumatoid arthritis
hsa05416  Viral myocarditis
Disease
H00099  Leukocyte adhesion deficiency
Drug target
Erlizumab: D04045
Fuzapladib sodium hydrate: D11919
Rovelizumab: D08993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    3689 (ITGB2)
   04390 Hippo signaling pathway
    3689 (ITGB2)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3689 (ITGB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3689 (ITGB2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3689 (ITGB2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    3689 (ITGB2)
   04613 Neutrophil extracellular trap formation
    3689 (ITGB2)
   04650 Natural killer cell mediated cytotoxicity
    3689 (ITGB2)
   04670 Leukocyte transendothelial migration
    3689 (ITGB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3689 (ITGB2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    3689 (ITGB2)
   05134 Legionellosis
    3689 (ITGB2)
   05150 Staphylococcus aureus infection
    3689 (ITGB2)
   05152 Tuberculosis
    3689 (ITGB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3689 (ITGB2)
   05144 Malaria
    3689 (ITGB2)
   05140 Leishmaniasis
    3689 (ITGB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    3689 (ITGB2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3689 (ITGB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3689 (ITGB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3689 (ITGB2)
   04515 Cell adhesion molecules [BR:hsa04515]
    3689 (ITGB2)
   04090 CD molecules [BR:hsa04090]
    3689 (ITGB2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3689 (ITGB2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3689 (ITGB2)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3689 (ITGB2)
CD molecules [BR:hsa04090]
 Proteins
  3689 (ITGB2)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 3689
NCBI-ProteinID: NP_000202
OMIM: 600065
HGNC: 6155
Ensembl: ENSG00000160255
Pharos: P05107(Tclin)
UniProt: P05107 A0A494C0X7
Structure
LinkDB
Position
21:complement(44885953..44928815)
AA seq 769 aa
MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSI
RCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFV
NTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFD
YPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAY
NKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC
IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKN
CECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTIN
CERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNV
CECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGR
TCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLL
VIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgctgggcctgcgccccccactgctcgccctggtggggctgctctccctcgggtgcgtc
ctctctcaggagtgcacgaagttcaaggtcagcagctgccgggaatgcatcgagtcgggg
cccggctgcacctggtgccagaagctgaacttcacagggccgggggatcctgactccatt
cgctgcgacacccggccacagctgctcatgaggggctgtgcggctgacgacatcatggac
cccacaagcctcgctgaaacccaggaagaccacaatgggggccagaagcagctgtcccca
caaaaagtgacgctttacctgcgaccaggccaggcagcagcgttcaacgtgaccttccgg
cgggccaagggctaccccatcgacctgtactatctgatggacctctcctactccatgctt
gatgacctcaggaatgtcaagaagctaggtggcgacctgctccgggccctcaacgagatc
accgagtccggccgcattggcttcgggtccttcgtggacaagaccgtgctgccgttcgtg
aacacgcaccctgataagctgcgaaacccatgccccaacaaggagaaagagtgccagccc
ccgtttgccttcaggcacgtgctgaagctgaccaacaactccaaccagtttcagaccgag
gtcgggaagcagctgatttccggaaacctggatgcacccgagggtgggctggacgccatg
atgcaggtcgccgcctgcccggaggaaatcggctggcgcaacgtcacgcggctgctggtg
tttgccactgatgacggcttccatttcgcgggcgacgggaagctgggcgccatcctgacc
cccaacgacggccgctgtcacctggaggacaacttgtacaagaggagcaacgaattcgac
tacccatcggtgggccagctggcgcacaagctggctgaaaacaacatccagcccatcttc
gcggtgaccagtaggatggtgaagacctacgagaaactcaccgagatcatccccaagtca
gccgtgggggagctgtctgaggactccagcaatgtggtccatctcattaagaatgcttac
aataaactctcctccagggtcttcctggatcacaacgccctccccgacaccctgaaagtc
acctacgactccttctgcagcaatggagtgacgcacaggaaccagcccagaggtgactgt
gatggcgtgcagatcaatgtcccgatcaccttccaggtgaaggtcacggccacagagtgc
atccaggagcagtcgtttgtcatccgggcgctgggcttcacggacatagtgaccgtgcag
gttcttccccagtgtgagtgccggtgccgggaccagagcagagaccgcagcctctgccat
ggcaagggcttcttggagtgcggcatctgcaggtgtgacactggctacattgggaaaaac
tgtgagtgccagacacagggccggagcagccaggagctggaaggaagctgccggaaggac
aacaactccatcatctgctcagggctgggggactgtgtctgcgggcagtgcctgtgccac
accagcgacgtccccggcaagctgatatacgggcagtactgcgagtgtgacaccatcaac
tgtgagcgctacaacggccaggtctgcggcggcccggggagggggctctgcttctgcggg
aagtgccgctgccacccgggctttgagggctcagcgtgccagtgcgagaggaccactgag
ggctgcctgaacccgcggcgtgttgagtgtagtggtcgtggccggtgccgctgcaacgta
tgcgagtgccattcaggctaccagctgcctctgtgccaggagtgccccggctgcccctca
ccctgtggcaagtacatctcctgcgccgagtgcctgaagttcgaaaagggcccctttggg
aagaactgcagcgcggcgtgtccgggcctgcagctgtcgaacaaccccgtgaagggcagg
acctgcaaggagagggactcagagggctgctgggtggcctacacgctggagcagcaggac
gggatggaccgctacctcatctatgtggatgagagccgagagtgtgtggcaggccccaac
atcgccgccatcgtcgggggcaccgtggcaggcatcgtgctgatcggcattctcctgctg
gtcatctggaaggctctgatccacctgagcgacctccgggagtacaggcgctttgagaag
gagaagctcaagtcccagtggaacaatgataatccccttttcaagagcgccaccacgacg
gtcatgaaccccaagtttgctgagagttag

KEGG   Homo sapiens (human): 3687
Entry
3687              CDS       T01001                                 
Symbol
ITGAX, CD11C, SLEB6
Name
(RefSeq) integrin subunit alpha X
  KO
K06462  integrin alpha X
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04810  Regulation of actin cytoskeleton
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3687 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    3687 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3687 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    3687 (ITGAX)
   04090 CD molecules [BR:hsa04090]
    3687 (ITGAX)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin alpha subunits
   3687 (ITGAX)
CD molecules [BR:hsa04090]
 Proteins
  3687 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 Integrin_alpha VWA_CoxE FG-GAP_2
Other DBs
NCBI-GeneID: 3687
NCBI-ProteinID: NP_000878
OMIM: 151510
HGNC: 6152
Ensembl: ENSG00000140678
Pharos: P20702(Tbio)
UniProt: P20702
Structure
LinkDB
Position
16:31355176..31382999
AA seq 1163 aa
MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAA
NQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNM
YLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQ
FQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLF
HASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKE
LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSL
VLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVV
IGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLV
DLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDK
RSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLP
SCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDN
LGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQ
LRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
SSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNL
GQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVL
DCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYS
QLPGQEAFMRAQTTTVLEKYKVHNPTPLIVGSSIGGLLLLALITAVLYKVGFFKRQYKEM
MEEANGQIAPENGTQTPSPPSEK
NT seq 3492 nt   +upstreamnt  +downstreamnt
atgaccaggaccagggcagcactcctcctgttcacagccttagcaacttctctaggtttc
aacttggacacagaggagctgacagccttccgtgtggacagcgctgggtttggagacagc
gtggtccagtatgccaactcctgggtggtggttggagccccccaaaagataacagctgcc
aaccaaacgggtggcctctaccagtgtggctacagcactggtgcctgtgagcccatcggc
ctgcaggtgcccccggaggccgtgaacatgtccctgggcctgtccctggcgtctaccacc
agcccttcccagctgctggcctgcggccccaccgtgcaccacgagtgcgggaggaacatg
tacctcaccggactctgcttcctcctgggccccacccagctcacccagaggctcccggtg
tccaggcaggagtgcccaagacaggagcaggacattgtgttcctgatcgatggctcaggc
agcatctcctcccgcaactttgccacgatgatgaacttcgtgagagctgtgataagccag
ttccagagacccagcacccagttttccctgatgcagttctccaacaaattccaaacacac
ttcactttcgaggaattcaggcgcagctcaaaccccctcagcctgttggcttctgttcac
cagctgcaagggtttacatacacggccaccgccatccaaaatgtcgtgcaccgattgttc
catgcctcatatggggcccgtagggatgccgccaaaattctcattgtcatcactgatggg
aagaaagaaggcgacagcctggattataaggatgtcatccccatggctgatgcagcaggc
atcatccgctatgcaattggggttggattagcttttcaaaacagaaattcttggaaagaa
ttaaatgacattgcatcgaagccctcccaggaacacatatttaaagtggaggactttgat
gctctgaaagatattcaaaaccaactgaaggagaagatctttgccattgagggtacggag
accacaagcagtagctccttcgaattggagatggcacaggagggcttcagcgctgtgttc
acacctgatggccccgttctgggggctgtggggagcttcacctggtctggaggtgccttc
ctgtaccccccaaatatgagccctaccttcatcaacatgtctcaggagaatgtggacatg
agggactcttacctgggttactccaccgagctggccctctggaaaggggtgcagagcctg
gtcctgggggccccccgctaccagcacaccgggaaggctgtcatcttcacccaggtgtcc
aggcaatggaggatgaaggccgaagtcacggggactcagatcggctcctacttcggggcc
tccctctgctccgtggacgtagacagcgacggcagcaccgacctggtcctcatcggggcc
ccccattactacgagcagacccgagggggccaggtgtctgtgtgtcccttgcccaggggg
tggagaaggtggtggtgtgatgctgttctctacggggagcagggccacccctggggtcgc
tttggggcggctctgacagtgctgggggatgtgaatggggacaagctgacagacgtggtc
atcggggccccaggagaggaggagaaccggggtgctgtctacctgtttcacggagtcttg
ggacccagcatcagcccctcccacagccagcggatcgcgggctcccagctctcctccagg
ctgcagtattttgggcaggcactgagcgggggtcaagacctcacccaggatggactggtg
gacctggctgtgggggcccggggccaggtgctcctgctcaggaccagacctgtgctctgg
gtgggggtgagcatgcagttcatacctgccgagatccccaggtctgcgtttgagtgtcgg
gagcaggtggtctctgagcagaccctggtacagtccaacatctgcctttacattgacaaa
cgttctaagaacctgcttgggagccgtgacctccaaagctctgtgaccttggacctggcc
ctcgaccctggccgcctgagtccccgtgccaccttccaggaaacaaagaaccggagtctg
agccgagtccgagtcctcgggctgaaggcacactgtgaaaacttcaacctgctgctcccg
agctgcgtggaggactctgtgacccccattaccttgcgtctgaacttcacgctggtgggc
aagcccctccttgccttcagaaacctgcggcctatgctggccgccgatgctcagagatac
ttcacggcctccctaccctttgagaagaactgtggagccgaccatatctgccaggacaat
ctcggcatctccttcagcttcccaggcttgaagtccctgctggtggggagtaacctggag
ctgaacgcagaagtgatggtgtggaatgacggggaagactcctacggaaccaccatcacc
ttctcccaccccgcaggactgtcctaccgctacgtggcagagggccagaaacaagggcag
ctgcgttccctgcacctgacatgtgacagcgccccagttgggagccagggcacctggagc
accagctgcagaatcaaccacctcatcttccgtggcggcgcccagatcaccttcttggct
acctttgacgtctcccccaaggctgtcctgggagaccggctgcttctgacagccaatgtg
agcagtgagaacaacactcccaggaccagcaagaccaccttccagctggagctcccggtg
aagtatgctgtctacactgtggttagcagccacgaacaattcaccaaatacctcaacttc
tcagagtctgaggagaaggaaagccatgtggccatgcacagataccaggtcaataacctg
ggacagagggacctgcctgtcagcatcaacttctgggtgcctgtggagctgaaccaggag
gctgtgtggatggatgtggaggtctcccacccccagaacccatcccttcggtgctcctca
gagaaaatcgcacccccagcatctgacttcctggcgcacattcagaagaatcccgtgctg
gactgctccattgctggctgcctgcggttccgctgtgacgtcccctccttcagcgtccag
gaggagctggatttcaccctgaagggcaacctcagctttggctgggtccgccagatattg
cagaagaaggtgtcggtcgtgagtgtggctgaaattacgttcgacacatccgtgtactcc
cagcttccaggacaggaggcatttatgagagctcagacgacaacggtgctggagaagtac
aaggtccacaaccccacccccctcatcgtaggcagctccattgggggtctgttgctgctg
gcactcatcacagcggtactgtacaaagttggcttcttcaagcgtcagtacaaggaaatg
atggaggaggcaaatggacaaattgccccagaaaacgggacacagacccccagcccgccc
agtgagaaatga

KEGG   Homo sapiens (human): 3689
Entry
3689              CDS       T01001                                 
Symbol
ITGB2, CD18, LAD, LCAMB, LFA-1, MAC-1, MF17, MFI7
Name
(RefSeq) integrin subunit beta 2
  KO
K06464  integrin beta 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04145  Phagosome
hsa04390  Hippo signaling pathway
hsa04514  Cell adhesion molecules
hsa04610  Complement and coagulation cascades
hsa04613  Neutrophil extracellular trap formation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05144  Malaria
hsa05146  Amoebiasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05166  Human T-cell leukemia virus 1 infection
hsa05323  Rheumatoid arthritis
hsa05416  Viral myocarditis
Disease
H00099  Leukocyte adhesion deficiency
Drug target
Erlizumab: D04045
Fuzapladib sodium hydrate: D11919
Rovelizumab: D08993
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    3689 (ITGB2)
   04390 Hippo signaling pathway
    3689 (ITGB2)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3689 (ITGB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3689 (ITGB2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    3689 (ITGB2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    3689 (ITGB2)
   04613 Neutrophil extracellular trap formation
    3689 (ITGB2)
   04650 Natural killer cell mediated cytotoxicity
    3689 (ITGB2)
   04670 Leukocyte transendothelial migration
    3689 (ITGB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3689 (ITGB2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    3689 (ITGB2)
   05134 Legionellosis
    3689 (ITGB2)
   05150 Staphylococcus aureus infection
    3689 (ITGB2)
   05152 Tuberculosis
    3689 (ITGB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3689 (ITGB2)
   05144 Malaria
    3689 (ITGB2)
   05140 Leishmaniasis
    3689 (ITGB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    3689 (ITGB2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3689 (ITGB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3689 (ITGB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3689 (ITGB2)
   04515 Cell adhesion molecules [BR:hsa04515]
    3689 (ITGB2)
   04090 CD molecules [BR:hsa04090]
    3689 (ITGB2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    3689 (ITGB2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3689 (ITGB2)
Cell adhesion molecules [BR:hsa04515]
 Integrins
  Integrin beta subunits
   3689 (ITGB2)
CD molecules [BR:hsa04090]
 Proteins
  3689 (ITGB2)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 3689
NCBI-ProteinID: NP_000202
OMIM: 600065
HGNC: 6155
Ensembl: ENSG00000160255
Pharos: P05107(Tclin)
UniProt: P05107 A0A494C0X7
Structure
LinkDB
Position
21:complement(44885953..44928815)
AA seq 769 aa
MLGLRPPLLALVGLLSLGCVLSQECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSI
RCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFV
NTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAM
MQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFD
YPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVHLIKNAY
NKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATEC
IQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKN
CECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTIN
CERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNV
CECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGR
TCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLL
VIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgctgggcctgcgccccccactgctcgccctggtggggctgctctccctcgggtgcgtc
ctctctcaggagtgcacgaagttcaaggtcagcagctgccgggaatgcatcgagtcgggg
cccggctgcacctggtgccagaagctgaacttcacagggccgggggatcctgactccatt
cgctgcgacacccggccacagctgctcatgaggggctgtgcggctgacgacatcatggac
cccacaagcctcgctgaaacccaggaagaccacaatgggggccagaagcagctgtcccca
caaaaagtgacgctttacctgcgaccaggccaggcagcagcgttcaacgtgaccttccgg
cgggccaagggctaccccatcgacctgtactatctgatggacctctcctactccatgctt
gatgacctcaggaatgtcaagaagctaggtggcgacctgctccgggccctcaacgagatc
accgagtccggccgcattggcttcgggtccttcgtggacaagaccgtgctgccgttcgtg
aacacgcaccctgataagctgcgaaacccatgccccaacaaggagaaagagtgccagccc
ccgtttgccttcaggcacgtgctgaagctgaccaacaactccaaccagtttcagaccgag
gtcgggaagcagctgatttccggaaacctggatgcacccgagggtgggctggacgccatg
atgcaggtcgccgcctgcccggaggaaatcggctggcgcaacgtcacgcggctgctggtg
tttgccactgatgacggcttccatttcgcgggcgacgggaagctgggcgccatcctgacc
cccaacgacggccgctgtcacctggaggacaacttgtacaagaggagcaacgaattcgac
tacccatcggtgggccagctggcgcacaagctggctgaaaacaacatccagcccatcttc
gcggtgaccagtaggatggtgaagacctacgagaaactcaccgagatcatccccaagtca
gccgtgggggagctgtctgaggactccagcaatgtggtccatctcattaagaatgcttac
aataaactctcctccagggtcttcctggatcacaacgccctccccgacaccctgaaagtc
acctacgactccttctgcagcaatggagtgacgcacaggaaccagcccagaggtgactgt
gatggcgtgcagatcaatgtcccgatcaccttccaggtgaaggtcacggccacagagtgc
atccaggagcagtcgtttgtcatccgggcgctgggcttcacggacatagtgaccgtgcag
gttcttccccagtgtgagtgccggtgccgggaccagagcagagaccgcagcctctgccat
ggcaagggcttcttggagtgcggcatctgcaggtgtgacactggctacattgggaaaaac
tgtgagtgccagacacagggccggagcagccaggagctggaaggaagctgccggaaggac
aacaactccatcatctgctcagggctgggggactgtgtctgcgggcagtgcctgtgccac
accagcgacgtccccggcaagctgatatacgggcagtactgcgagtgtgacaccatcaac
tgtgagcgctacaacggccaggtctgcggcggcccggggagggggctctgcttctgcggg
aagtgccgctgccacccgggctttgagggctcagcgtgccagtgcgagaggaccactgag
ggctgcctgaacccgcggcgtgttgagtgtagtggtcgtggccggtgccgctgcaacgta
tgcgagtgccattcaggctaccagctgcctctgtgccaggagtgccccggctgcccctca
ccctgtggcaagtacatctcctgcgccgagtgcctgaagttcgaaaagggcccctttggg
aagaactgcagcgcggcgtgtccgggcctgcagctgtcgaacaaccccgtgaagggcagg
acctgcaaggagagggactcagagggctgctgggtggcctacacgctggagcagcaggac
gggatggaccgctacctcatctatgtggatgagagccgagagtgtgtggcaggccccaac
atcgccgccatcgtcgggggcaccgtggcaggcatcgtgctgatcggcattctcctgctg
gtcatctggaaggctctgatccacctgagcgacctccgggagtacaggcgctttgagaag
gagaagctcaagtcccagtggaacaatgataatccccttttcaagagcgccaccacgacg
gtcatgaaccccaagtttgctgagagttag

KEGG   Homo sapiens (human): 727
Entry
727               CDS       T01001                                 
Symbol
C5, C5D, C5a, C5b, CPAMD4, ECLZB
Name
(RefSeq) complement C5
  KO
K03994  complement component 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
hsa04613  Neutrophil extracellular trap formation
hsa04810  Regulation of actin cytoskeleton
hsa04936  Alcoholic liver disease
hsa05020  Prion disease
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05168  Herpes simplex virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06513  Complement cascade
  Element
N01490  Common pathway of complement cascade, MAC formation
Disease
H00103  Late complement pathway defects
Drug target
Avacincaptad pegol sodium: D11748
Crovalimab: D11696
Eculizumab: D03940<JP/US>
Gefurulimab: D12208
Nomacopan: D11473
Olendalizumab: D11331
Pexelizumab: D10023
Pozelimab: D11477
Ravulizumab: D11054<JP/US>
Vilobelimab: D11838
Zilucoplan (DG03224): D12356 D12357
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    727 (C5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    727 (C5)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    727 (C5)
   04613 Neutrophil extracellular trap formation
    727 (C5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    727 (C5)
   05168 Herpes simplex virus 1 infection
    727 (C5)
  09171 Infectious disease: bacterial
   05133 Pertussis
    727 (C5)
   05150 Staphylococcus aureus infection
    727 (C5)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    727 (C5)
  09164 Neurodegenerative disease
   05020 Prion disease
    727 (C5)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    727 (C5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    727 (C5)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   727 (C5)
SSDB
Motif
Pfam: TED_complement MG1 A2M A2M_BRD A2M_recep NTR MG4 MG2 MG3 ANATO
Other DBs
NCBI-GeneID: 727
NCBI-ProteinID: NP_001726
OMIM: 120900
HGNC: 1331
Ensembl: ENSG00000106804
Pharos: P01031(Tclin)
CPD: C16510 C22545
UniProt: P01031
Structure
LinkDB
Position
9:complement(120952335..121074865)
AA seq 1676 aa
MGLLGILCFLIFLGKTWGQEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYP
DKKFSYSSGHVHLSSENKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPIT
YDNGFLFIHTDKPVYTPDQSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHI
GIISFPDFKIPSNPRYGMWTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGY
KNFKNFEITIKARYFYNKVVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVT
FDSETAVKELSYYSLEDLNNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATP
LFLKPGIPYPIKVQVKDSLDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASF
VLNLPSGVTVLEFNVKTDAPDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGE
HLNIIVTPKSPYIDKITHYNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRL
LVYYIVTGEQTAELVSDSVWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWV
ALAAVDSAVYGVQRGAKKPLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANAD
DSQENDEPCKEILRPRRTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISL
GPRCIKAFTECCVVASQLRANISHKDMQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLV
PRRKQLQFALPDSLTTWEIQGVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQ
LKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTV
LPLEIGLHNINFSLETWFGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFP
YRIPLDLVPKTEIKRILSVKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFY
VFHYLETGNHWNIFHSDPLIEKQKLKKKLKEGMLSIMSYRNADYSYSVWKGGSASTWLTA
FALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEAREN
SLYLTAFTVIGIRKAFDICPLVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDK
THPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLN
LKDINYVNPVIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHK
GALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLK
IDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLK
ALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHR
PDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYA
YKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIM
GKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC
NT seq 5031 nt   +upstreamnt  +downstreamnt
atgggccttttgggaatactttgttttttaatcttcctggggaaaacctggggacaggag
caaacatatgtcatttcagcaccaaaaatattccgtgttggagcatctgaaaatattgtg
attcaagtttatggatacactgaagcatttgatgcaacaatctctattaaaagttatcct
gataaaaaatttagttactcctcaggccatgttcatttatcctcagagaataaattccaa
aactctgcaatcttaacaatacaaccaaaacaattgcctggaggacaaaacccagtttct
tatgtgtatttggaagttgtatcaaagcatttttcaaaatcaaaaagaatgccaataacc
tatgacaatggatttctcttcattcatacagacaaacctgtttatactccagaccagtca
gtaaaagttagagtttattcgttgaatgacgacttgaagccagccaaaagagaaactgtc
ttaactttcatagatcctgaaggatcagaagttgacatggtagaagaaattgatcatatt
ggaattatctcttttcctgacttcaagattccgtctaatcctagatatggtatgtggacg
atcaaggctaaatataaagaggacttttcaacaactggaaccgcatattttgaagttaaa
gaatatgtcttgccacatttttctgtctcaatcgagccagaatataatttcattggttac
aagaactttaagaattttgaaattactataaaagcaagatatttttataataaagtagtc
actgaggctgacgtttatatcacatttggaataagagaagacttaaaagatgatcaaaaa
gaaatgatgcaaacagcaatgcaaaacacaatgttgataaatggaattgctcaagtcaca
tttgattctgaaacagcagtcaaagaactgtcatactacagtttagaagatttaaacaac
aagtacctttatattgctgtaacagtcatagagtctacaggtggattttctgaagaggca
gaaatacctggcatcaaatatgtcctctctccctacaaactgaatttggttgctactcct
cttttcctgaagcctgggattccatatcccatcaaggtgcaggttaaagattcgcttgac
cagttggtaggaggagtcccagtaacactgaatgcacaaacaattgatgtaaaccaagag
acatctgacttggatccaagcaaaagtgtaacacgtgttgatgatggagtagcttccttt
gtgcttaatctcccatctggagtgacggtgctggagtttaatgtcaaaactgatgctcca
gatcttccagaagaaaatcaggccagggaaggttaccgagcaatagcatactcatctctc
agccaaagttacctttatattgattggactgataaccataaggctttgctagtgggagaa
catctgaatattattgttacccccaaaagcccatatattgacaaaataactcactataat
tacttgattttatccaagggcaaaattatccactttggcacgagggagaaattttcagat
gcatcttatcaaagtataaacattccagtaacacagaacatggttccttcatcccgactt
ctggtctattacatcgtcacaggagaacagacagcagaattagtgtctgattcagtctgg
ttaaatattgaagaaaaatgtggcaaccagctccaggttcatctgtctcctgatgcagat
gcatattctccaggccaaactgtgtctcttaatatggcaactggaatggattcctgggtg
gcattagcagcagtggacagtgctgtgtatggagtccaaagaggagccaaaaagcccttg
gaaagagtatttcaattcttagagaagagtgatctgggctgtggggcaggtggtggcctc
aacaatgccaatgtgttccacctagctggacttaccttcctcactaatgcaaatgcagat
gactcccaagaaaatgatgaaccttgtaaagaaattctcaggccaagaagaacgctgcaa
aagaagatagaagaaatagctgctaaatataaacattcagtagtgaagaaatgttgttac
gatggagcctgcgttaataatgatgaaacctgtgagcagcgagctgcacggattagttta
gggccaagatgcatcaaagctttcactgaatgttgtgtcgtcgcaagccagctccgtgct
aatatctctcataaagacatgcaattgggaaggctacacatgaagaccctgttaccagta
agcaagccagaaattcggagttattttccagaaagctggttgtgggaagttcatcttgtt
cccagaagaaaacagttgcagtttgccctacctgattctctaaccacctgggaaattcaa
ggcgttggcatttcaaacactggtatatgtgttgctgatactgtcaaggcaaaggtgttc
aaagatgtcttcctggaaatgaatataccatattctgttgtacgaggagaacagatccaa
ttgaaaggaactgtttacaactataggacttctgggatgcagttctgtgttaaaatgtct
gctgtggagggaatctgcacttcggaaagcccagtcattgatcatcagggcacaaagtcc
tccaaatgtgtgcgccagaaagtagagggctcctccagtcacttggtgacattcactgtg
cttcctctggaaattggccttcacaacatcaatttttcactggagacttggtttggaaaa
gaaatcttagtaaaaacattacgagtggtgccagaaggtgtcaaaagggaaagctattct
ggtgttactttggatcctaggggtatttatggtaccattagcagacgaaaggagttccca
tacaggatacccttagatttggtccccaaaacagaaatcaaaaggattttgagtgtaaaa
ggactgcttgtaggtgagatcttgtctgcagttctaagtcaggaaggcatcaatatccta
acccacctccccaaagggagtgcagaggcggagctgatgagcgttgtcccagtattctat
gtttttcactacctggaaacaggaaatcattggaacatttttcattctgacccattaatt
gaaaagcagaaactgaagaaaaaattaaaagaagggatgttgagcattatgtcctacaga
aatgctgactactcttacagtgtgtggaagggtggaagtgctagcacttggttaacagct
tttgctttaagagtacttggacaagtaaataaatacgtagagcagaaccaaaattcaatt
tgtaattctttattgtggctagttgagaattatcaattagataatggatctttcaaggaa
aattcacagtatcaaccaataaaattacagggtaccttgcctgttgaagcccgagagaac
agcttatatcttacagcctttactgtgattggaattagaaaggctttcgatatatgcccc
ctggtgaaaatcgacacagctctaattaaagctgacaactttctgcttgaaaatacactg
ccagcccagagcacctttacattggccatttctgcgtatgctctttccctgggagataaa
actcacccacagtttcgttcaattgtttcagctttgaagagagaagctttggttaaaggt
aatccacccatttatcgtttttggaaagacaatcttcagcataaagacagctctgtacct
aacactggtacggcacgtatggtagaaacaactgcctatgctttactcaccagtctgaac
ttgaaagatataaattatgttaacccagtcatcaaatggctatcagaagagcagaggtat
ggaggtggcttttattcaacccaggacacaatcaatgccattgagggcctgacggaatat
tcactcctggttaaacaactccgcttgagtatggacatcgatgtttcttacaagcataaa
ggtgccttacataattataaaatgacagacaagaatttccttgggaggccagtagaggtg
cttctcaatgatgacctcattgtcagtacaggatttggcagtggcttggctacagtacat
gtaacaactgtagttcacaaaaccagtacctctgaggaagtttgcagcttttatttgaaa
atcgatactcaggatattgaagcatcccactacagaggctacggaaactctgattacaaa
cgcatagtagcatgtgccagctacaagcccagcagggaagaatcatcatctggatcctct
catgcggtgatggacatctccttgcctactggaatcagtgcaaatgaagaagacttaaaa
gcccttgtggaaggggtggatcaactattcactgattaccaaatcaaagatggacatgtt
attctgcaactgaattcgattccctccagtgatttcctttgtgtacgattccggatattt
gaactctttgaagttgggtttctcagtcctgccactttcacagtgtacgaataccacaga
ccagataaacagtgtaccatgttttatagcacttccaatatcaaaattcagaaagtctgt
gaaggagccgcgtgcaagtgtgtagaagctgattgtgggcaaatgcaggaagaattggat
ctgacaatctctgcagagacaagaaaacaaacagcatgtaaaccagagattgcatatgct
tataaagttagcatcacatccatcactgtagaaaatgtttttgtcaagtacaaggcaacc
cttctggatatctacaaaactggggaagctgttgctgagaaagactctgagattaccttc
attaaaaaggtaacctgtactaacgctgagctggtaaaaggaagacagtacttaattatg
ggtaaagaagccctccagataaaatacaatttcagtttcaggtacatctaccctttagat
tccttgacctggattgaatactggcctagagacacaacatgttcatcgtgtcaagcattt
ttagctaatttagatgaatttgccgaagatatctttttaaatggatgctaa

KEGG   Homo sapiens (human): 729
Entry
729               CDS       T01001                                 
Symbol
C6
Name
(RefSeq) complement C6
  KO
K03995  complement component 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04810  Regulation of actin cytoskeleton
hsa05020  Prion disease
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06513  Complement cascade
  Element
N01490  Common pathway of complement cascade, MAC formation
N01505  Regulation of complement cascade, MAC inhibition
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    729 (C6)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    729 (C6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    729 (C6)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    729 (C6)
  09164 Neurodegenerative disease
   05020 Prion disease
    729 (C6)
SSDB
Motif
Pfam: MACPF Sushi TSP_1 TSP1_spondin Ldl_recept_a Kazal_3
Other DBs
NCBI-GeneID: 729
NCBI-ProteinID: NP_000056
OMIM: 217050
HGNC: 1339
Ensembl: ENSG00000039537
Pharos: P13671(Tbio)
UniProt: P13671
Structure
LinkDB
Position
5:complement(41142116..41261469)
AA seq 934 aa
MARRSVLYFILLNALINKGQACFCDHYAWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENF
CEQICSKQETRECNWQRCPINCLLGDFGPWSDCDPCIEKQSKVRSVLRPSQFGGQPCTAP
LVAFQPCIPSKLCKIEEADCKNKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVC
TRKYNPIPSVQLMGNGFHFLAGEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVG
FEVQTAEDDLKTDFYKDLTSLGHNENQQGSFSSQGGSSFSVPIFYSSKRSENINHNSAFK
QAIQASHKKDSSFIRIHKVMKVLNFTTKAKDLHLSDVFLKALNHLPLEYNSALYSRIFDD
FGTHYFTSGSLGGVYDLLYQFSSEELKNSGLTEEEAKHCVRIETKKRVLFAKKTKVEHRC
TTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENP
AVIDFELAPIVDLVRNIPCAVTKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECL
CVCQSGTYGENCEKQSPDYKSNAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKR
CEGEKRQEEDCTFSIMENNGQPCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQ
LYLVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQR
LYRIGESIELTCPKGFVVAGPSRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQS
GSECICMSPEEDCSHHSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDG
RQLEWGLERTRLSSNSTKKESCGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKM
GSSTSEKTLNICEVGTIRCANRKMEILHPGKCLA
NT seq 2805 nt   +upstreamnt  +downstreamnt
atggccagacgctctgtcttgtacttcatcctgctgaatgctctgatcaacaagggccaa
gcctgcttctgtgatcactatgcatggactcagtggaccagctgctcaaaaacttgcaat
tctggaacccagagcagacacagacaaatagtagtagataagtactaccaggaaaacttt
tgtgaacagatttgcagcaagcaggagactagagaatgtaactggcaaagatgccccatc
aactgcctcctgggagattttggaccatggtcagactgtgacccttgtattgaaaaacag
tctaaagttagatctgtcttgcgtcccagtcagtttgggggacagccatgcactgcgcct
ctggtagcctttcaaccatgcattccatctaagctctgcaaaattgaagaggctgactgc
aagaataaatttcgctgtgacagtggccgctgcattgccagaaagttagaatgcaatgga
gaaaatgactgtggagacaattcagatgaaagggactgtgggaggacaaaggcagtatgc
acacggaagtataatcccatccctagtgtacagttgatgggcaatgggtttcattttctg
gcaggagagcccagaggagaagtccttgataactctttcactggaggaatatgtaaaact
gtcaaaagcagtaggacaagtaatccataccgtgttccggccaatctggaaaatgtcggc
tttgaggtacaaactgcagaagatgacttgaaaacagatttctacaaggatttaacttct
cttggacacaatgaaaatcaacaaggctcattctcaagtcagggggggagctctttcagt
gtaccaattttttattcctcaaagagaagtgaaaatatcaaccataattctgccttcaaa
caagccattcaagcctctcacaaaaaggattctagttttattaggatccataaagtgatg
aaagtcttaaacttcacaacgaaagctaaagatctgcacctttctgatgtctttttgaaa
gcacttaaccatctgcctctagaatacaactctgctttgtacagccgaatattcgatgac
tttgggactcattacttcacctctggctccctgggaggcgtgtatgaccttctctatcag
tttagcagtgaggaactaaagaactcaggtttaaccgaggaagaagccaaacactgtgtc
aggattgaaacaaagaaacgcgttttatttgctaagaaaacaaaagtggaacataggtgc
accaccaacaagctgtcagagaaacatgaaggttcatttatacagggagcagagaaatcc
atatccctgattcgaggtggaaggagtgaatatggagcagctttggcatgggagaaaggg
agctctggtctggaggagaagacattttctgagtggttagaatcagtgaaggaaaatcct
gctgtgattgactttgagcttgcccccatcgtggacttggtaagaaacatcccctgtgca
gtgacaaaacggaacaacctcaggaaagctttgcaagagtatgcagccaagttcgatcct
tgccagtgtgctccatgccctaataatggccgacccaccctctcagggactgaatgtctg
tgtgtgtgtcagagtggcacctatggtgagaactgtgagaaacagtctccagattataaa
tccaatgcagtagacggacagtggggttgttggtcttcctggagtacctgtgatgctact
tataagagatcgagaacccgagaatgcaataatcctgccccccaacgaggagggaaacgc
tgtgagggggagaagcgacaagaggaagactgcacattttcaatcatggaaaacaatgga
caaccatgtatcaatgatgacgaagaaatgaaagaggtcgatcttcctgagatagaagca
gattccgggtgtcctcagccagttcctccagaaaatggatttatccggaatgaaaagcaa
ctatacttggttggagaagatgttgaaatttcatgccttactggctttgaaactgttgga
taccagtacttcagatgcttaccagacgggacctggagacaaggggatgtggaatgccaa
cggacggagtgcatcaagccagttgtgcaggaagtcctgacaattacaccatttcagaga
ttgtatagaattggtgaatccattgagctaacttgccccaaaggctttgttgttgctggg
ccatcaaggtacacatgccaggggaattcctggacaccacccatttcaaactctctcacc
tgtgaaaaagatactctaacaaaattaaaaggccattgtcagctgggacagaaacaatca
ggatctgaatgcatttgtatgtctccagaagaagactgtagccatcattcagaagatctc
tgtgtgtttgacacagactccaacgattactttacttcacccgcttgtaagtttttggct
gagaaatgtttaaataatcagcaactccattttctacatattggttcctgccaagacggc
cgccagttagaatggggtcttgaaaggacaagactttcatccaacagcacaaagaaagaa
tcctgtggctatgacacctgctatgactgggaaaaatgttcagcctccacttccaaatgt
gtctgcctattgcccccacagtgcttcaagggtggaaaccaactctactgtgtcaaaatg
ggatcatcaacaagtgagaaaacattgaacatctgtgaagtgggaactataagatgtgca
aacaggaagatggaaatactgcatcctggaaagtgtttggcctag

KEGG   Homo sapiens (human): 730
Entry
730               CDS       T01001                                 
Symbol
C7
Name
(RefSeq) complement C7
  KO
K03996  complement component 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04810  Regulation of actin cytoskeleton
hsa05020  Prion disease
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06513  Complement cascade
  Element
N01490  Common pathway of complement cascade, MAC formation
N01505  Regulation of complement cascade, MAC inhibition
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    730 (C7)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    730 (C7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    730 (C7)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    730 (C7)
  09164 Neurodegenerative disease
   05020 Prion disease
    730 (C7)
SSDB
Motif
Pfam: MACPF Kazal_3 Sushi TSP1_spondin TSP_1 Ldl_recept_a
Other DBs
NCBI-GeneID: 730
NCBI-ProteinID: NP_000578
OMIM: 217070
HGNC: 1346
Ensembl: ENSG00000112936
Pharos: P10643(Tbio)
UniProt: P10643 Q05CI3
Structure
LinkDB
Position
5:40909497..40984643
AA seq 843 aa
MKVISLFILVGFIGEFQSFSSASSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCVGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRPSCDIDKPPPNIELTGNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLS
GNVLSYTFQVKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKRSFFRSSSSSSRSYTSHTN
EIHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYG
THYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENAL
KAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQK
LTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPY
TFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETT
ESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCN
EGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCS
GGMSLEGPSAFLCGSSLKWSPEMKNARCVQKENPLTQAVPKCQRWEKLQNSRCVCKMPYE
CGPSLDVCAQDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWG
KCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAA
ETQ
NT seq 2532 nt   +upstreamnt  +downstreamnt
atgaaggtgataagcttattcattttggtgggatttataggagagttccaaagtttttca
agtgcctcctctccagtcaactgccagtgggacttctatgccccttggtcagaatgcaat
ggctgtaccaagactcagactcgcaggcggtcagttgctgtgtatgggcagtatggaggc
cagccttgtgttggaaatgcttttgaaacacagtcctgtgaacctacaagaggatgtcca
acagaggagggatgtggagagcgtttcaggtgcttttcaggtcagtgcatcagcaaatca
ttggtttgcaatggggattctgactgtgatgaagacagtgctgatgaagacagatgtgag
gactcagaaaggagaccttcctgtgatatcgataaacctcctcctaacatagaacttact
ggaaatggttacaatgaactcactggccagtttaggaacagagtcatcaataccaaaagt
tttggtggtcaatgtagaaaggtgtttagtggggatggaaaagatttctacaggctgagt
ggaaatgtcctgtcctatacattccaggtgaaaataaataatgattttaattatgaattt
tacaatagtacttggtcttatgtaaaacatacgtcgacagaacacacatcatctagtcgg
aagcgctccttttttagatcttcatcatcttcttcacgcagttatacttcacataccaat
gaaatccataaaggaaagagttaccaactgctggttgttgagaacactgttgaagtggct
cagttcattaataacaatccagaatttttacaacttgctgagccattctggaaggagctt
tcccacctcccctctctgtatgactacagtgcctaccgaagattaatcgaccagtacggg
acacattatctgcaatctgggtcgttaggaggagaatacagagttctattttatgtggac
tcagaaaaattaaaacaaaatgattttaattcagtcgaagaaaagaaatgtaaatcctca
ggttggcattttgtcgttaaattttcaagtcatggatgcaaggaactggaaaacgcttta
aaagctgcttcaggaacccagaacaatgtattgcgaggagaaccgttcatcagaggggga
ggtgcaggcttcatatctggccttagttacctagagctggacaatcctgctggaaacaaa
aggcgatattctgcctgggcagaatctgtgactaatcttcctcaagtcataaaacaaaag
ctgacacctttatatgagctggtaaaggaagtaccttgtgcctctgtgaaaaaactatac
ctgaaatgggctcttgaagagtatctggatgaatttgacccctgtcattgccggccttgt
caaaatggtggtttggctactgttgaggggacccattgtctgtgccattgcaaaccgtac
acatttggtgcggcgtgtgagcaaggagtcctcgtagggaatcaagcaggaggggttgat
ggaggttggagttgctggtcctcttggagcccctgtgtccaagggaagaaaacaagaagc
cgtgaatgcaataacccacctcccagtgggggtgggagatcctgcgttggagaaacgaca
gaaagcacacaatgcgaagatgaggagctggagcacttgaggttgcttgaaccacattgc
tttcctttgtctttggttccaacagaattctgtccatcacctcctgccttgaaagatgga
tttgttcaagatgaaggtacaatgtttcctgtggggaaaaatgtagtgtacacttgcaat
gaaggatactctcttattggaaacccagtggccagatgtggagaagatttacggtggctt
gttggggaaatgcattgtcagaaaattgcctgtgttctacctgtactgatggatggcata
cagagtcacccccaaaaacctttctacacagttggtgagaaggtgactgtttcctgttca
ggtggcatgtccttagaaggtccttcagcatttctctgtggctccagccttaagtggagt
cctgagatgaagaatgcccgctgtgtacaaaaagaaaatccgttaacacaggcagtgcct
aaatgtcagcgctgggagaaactgcagaattcaagatgtgtttgtaaaatgccctacgaa
tgtggaccttccttggatgtatgtgctcaagatgagagaagcaaaaggatactgcctctg
acagtttgcaagatgcatgttctccactgtcagggtagaaattacacccttactggtagg
gacagctgtactctgcctgcctcagctgagaaagcttgtggtgcctgcccactgtgggga
aaatgtgatgctgagagcagcaaatgtgtctgccgagaagcatcggagtgcgaggaagaa
gggtttagcatttgtgtggaagtgaacggcaaggagcagacgatgtctgagtgtgaggcg
ggcgctctgagatgcagagggcagagcatctctgtcaccagcataaggccttgtgctgcg
gaaacccagtag

DBGET integrated database retrieval system