KEGG   Homo sapiens (human): 11337
Entry
11337             CDS       T01001                                 
Symbol
GABARAP, ATG8A, GABARAP-a, MM46
Name
(RefSeq) GABA type A receptor-associated protein
  KO
K08341  GABA(A) receptor-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04136  Autophagy - other
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04621  NOD-like receptor signaling pathway
hsa04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    11337 (GABARAP)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    11337 (GABARAP)
   04136 Autophagy - other
    11337 (GABARAP)
   04137 Mitophagy - animal
    11337 (GABARAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    11337 (GABARAP)
  09156 Nervous system
   04727 GABAergic synapse
    11337 (GABARAP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11337 (GABARAP)
   04121 Ubiquitin system [BR:hsa04121]
    11337 (GABARAP)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    11337 (GABARAP)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    11337 (GABARAP)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   11337 (GABARAP)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    11337 (GABARAP)
SSDB
Motif
Pfam: ATG8 APG12
Other DBs
NCBI-GeneID: 11337
NCBI-ProteinID: NP_009209
OMIM: 605125
HGNC: 4067
Ensembl: ENSG00000170296
Pharos: O95166(Tbio)
UniProt: O95166 Q6IAW1
Structure
LinkDB
Position
17:complement(7240008..7242449)
AA seq 117 aa
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagttcgtgtacaaagaagagcatccgttcgagaagcgccgctctgagggcgagaag
atccgaaagaaatacccggaccgggtgccggtgatagtagaaaaggctcccaaagctcgg
ataggagacctggacaaaaagaaatacctggtgccttctgatctcacagttggtcagttc
tacttcttgatccggaagcgaattcatctccgagctgaggatgccttgtttttctttgtc
aacaatgtcattccacccaccagtgccacaatgggtcagctgtaccaggaacaccatgaa
gaagacttctttctctacattgcctacagtgacgaaagtgtctacggtctgtga

KEGG   Homo sapiens (human): 11345
Entry
11345             CDS       T01001                                 
Symbol
GABARAPL2, ATG8, ATG8C, GATE-16, GATE16, GEF-2, GEF2
Name
(RefSeq) GABA type A receptor associated protein like 2
  KO
K08341  GABA(A) receptor-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04136  Autophagy - other
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04621  NOD-like receptor signaling pathway
hsa04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    11345 (GABARAPL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    11345 (GABARAPL2)
   04136 Autophagy - other
    11345 (GABARAPL2)
   04137 Mitophagy - animal
    11345 (GABARAPL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    11345 (GABARAPL2)
  09156 Nervous system
   04727 GABAergic synapse
    11345 (GABARAPL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    11345 (GABARAPL2)
   04121 Ubiquitin system [BR:hsa04121]
    11345 (GABARAPL2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    11345 (GABARAPL2)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    11345 (GABARAPL2)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   11345 (GABARAPL2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    11345 (GABARAPL2)
SSDB
Motif
Pfam: ATG8 APG12
Other DBs
NCBI-GeneID: 11345
NCBI-ProteinID: NP_009216
OMIM: 607452
HGNC: 13291
Ensembl: ENSG00000034713
Pharos: P60520(Tbio)
UniProt: P60520
Structure
LinkDB
Position
16:75566379..75577881
AA seq 117 aa
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQF
MWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagtggatgttcaaggaggaccactcgctggaacacagatgcgtggagtccgcgaag
attcgagcgaaatatcccgacagggttccggtgattgtggaaaaggtctcaggctctcag
attgttgacattgacaaacggaagtacttggttccatctgatatcactgtggctcagttc
atgtggatcatcaggaaaaggatccagcttccttctgaaaaggcgatcttcctgtttgtg
gataagacagtcccacagtccagcctaactatgggacagctttacgagaaggaaaaagat
gaagatggattcttatatgtggcctacagcggagagaacacttttggcttctga

KEGG   Homo sapiens (human): 23710
Entry
23710             CDS       T01001                                 
Symbol
GABARAPL1, APG8-LIKE, APG8L, ATG8, ATG8B, ATG8L, GEC1
Name
(RefSeq) GABA type A receptor associated protein like 1
  KO
K08341  GABA(A) receptor-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04136  Autophagy - other
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04621  NOD-like receptor signaling pathway
hsa04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    23710 (GABARAPL1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    23710 (GABARAPL1)
   04136 Autophagy - other
    23710 (GABARAPL1)
   04137 Mitophagy - animal
    23710 (GABARAPL1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    23710 (GABARAPL1)
  09156 Nervous system
   04727 GABAergic synapse
    23710 (GABARAPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23710 (GABARAPL1)
   04121 Ubiquitin system [BR:hsa04121]
    23710 (GABARAPL1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    23710 (GABARAPL1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    23710 (GABARAPL1)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   23710 (GABARAPL1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    23710 (GABARAPL1)
SSDB
Motif
Pfam: ATG8 APG12 VitD-bind_III
Other DBs
NCBI-GeneID: 23710
NCBI-ProteinID: NP_113600
OMIM: 607420
HGNC: 4068
Ensembl: ENSG00000139112
Pharos: Q9H0R8(Tbio)
UniProt: Q9H0R8 A0A024RAP5
Structure
LinkDB
Position
12:10212877..10223128
AA seq 117 aa
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagttccagtacaaggaggaccatccctttgagtatcggaaaaaggaaggagaaaag
atccggaagaaatatccggacagggtccccgtgattgtagagaaggctccaaaagccagg
gtgcctgatctggacaagaggaagtacctagtgccctctgaccttactgttggccagttc
tacttcttaatccggaagagaatccacctgagacctgaggacgccttattcttctttgtc
aacaacaccatccctcccaccagtgctaccatgggccaactgtatgaggacaatcatgag
gaagactattttctgtatgtggcctacagtgatgagagtgtctatgggaaatga

DBGET integrated database retrieval system