KEGG   Homo sapiens (human): 1134
Entry
1134              CDS       T01001                                 
Symbol
CHRNA1, ACHRA, ACHRD, CHRNA, CMS1A, CMS1B, CMS2A, FCCMS, SCCMS
Name
(RefSeq) cholinergic receptor nicotinic alpha 1 subunit
  KO
K04803  nicotinic acetylcholine receptor alpha-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00770  Congenital myasthenic syndrome
H00986  Multiple pterygium syndrome
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Cytisinicline: D07770
Gantacurium chloride: D04303
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Metocurine iodide: D00761
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Suxamethonium (DG00768): D00766<US> D02275<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1134 (CHRNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1134 (CHRNA1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1134 (CHRNA1)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Other DBs
NCBI-GeneID: 1134
NCBI-ProteinID: NP_000070
OMIM: 100690
HGNC: 1955
Ensembl: ENSG00000138435
Pharos: P02708(Tclin)
UniProt: P02708 Q53SH4
Structure
LinkDB
Position
2:complement(174747592..174764472)
AA seq 457 aa
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQL
INVDEVNQIVTTNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDF
AIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINP
ESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLPLYFIVNVII
PCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLF
TMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKK
IFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSAIEGIKYIAETMKSDQESNNAAAEWK
YVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQQG
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggagccctggcctctcctcctgctctttagcctttgctcagctggcctcgtcctgggc
tccgaacatgagacccgtctggtggcaaagctatttaaagactacagcagcgtggtgcgg
ccagtggaagaccaccgccaggtcgtggaggtcaccgtgggcctgcagctgatacagctc
atcaatgtggatgaagtaaatcagatcgtgacaaccaatgtgcgtctgaaacagcaatgg
gtggattacaacctaaaatggaatccagatgactatggcggtgtgaaaaaaattcacatt
ccttcagaaaagatctggcgcccagaccttgttctctataacaatgcagatggtgacttt
gctattgtcaagttcaccaaagtgctcctgcagtacactggccacatcacgtggacacct
ccagccatctttaaaagctactgtgagatcatcgtcacccactttccctttgatgaacag
aactgcagcatgaagctgggcacctggacctacgacggctctgtcgtggccatcaacccg
gaaagcgaccagccagacctgagcaacttcatggagagcggggagtgggtgatcaaggag
tcccggggctggaagcactccgtgacctattcctgctgccccgacaccccctacctggac
atcacctaccacttcgtcatgcagcgcctgcccctctacttcatcgtcaacgtcatcatc
ccctgcctgctcttctccttcttaactggcctggtattctacctgcccacagactcaggg
gagaagatgactctgagcatctctgtcttactgtctttgactgtgttccttctggtcatc
gtggagctgatcccctccacgtccagtgctgtgcccttgattggaaaatacatgctgttc
accatggtgttcgtcattgcctccatcatcatcactgtcatcgtcatcaacacacaccac
cgctcacccagcacccatgtcatgcccaactgggtgcggaaggtttttatcgacactatc
ccaaatatcatgtttttctccacaatgaaaagaccatccagagaaaagcaagacaaaaag
atttttacagaagacattgatatctctgacatttctggaaagccagggcctccacccatg
ggcttccactctcccctgatcaaacaccccgaggtgaaaagtgccatcgagggcatcaag
tacatcgcagagaccatgaagtcagaccaggagtctaacaatgcggcggcagagtggaag
tacgttgcaatggtgatggaccacatactcctcggagtcttcatgcttgtttgcatcatc
ggaaccctagccgtgtttgcaggtcgactcattgaattaaatcagcaaggatga

KEGG   Homo sapiens (human): 1135
Entry
1135              CDS       T01001                                 
Symbol
CHRNA2
Name
(RefSeq) cholinergic receptor nicotinic alpha 2 subunit
  KO
K04804  nicotinic acetylcholine receptor alpha-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00807  Nocturnal frontal lobe epilepsy
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisinicline: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1135 (CHRNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1135 (CHRNA2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1135 (CHRNA2)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD Atrophin-1 DUF2417
Other DBs
NCBI-GeneID: 1135
NCBI-ProteinID: NP_000733
OMIM: 118502
HGNC: 1956
Ensembl: ENSG00000120903
Pharos: Q15822(Tchem)
UniProt: Q15822
Structure
LinkDB
Position
8:complement(27459756..27479261)
AA seq 529 aa
MGPSCPVFLSFTKLSLWWLLLTPAGGEEAKRPPPRAPGDPLSSPSPTALPQGGSHTETED
RLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKL
RWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYK
SSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAIVNATGTY
NSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLC
ISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTH
TMPHWVRGALLGCVPRWLLMNRPPPPVELCHPLRLKLSPSYHWLESNVDAEEREVVVEEE
DRWACAGHVAPSVGTLCSHGHLHSGASGPKAEALLQEGELLLSPHMQKALEGVHYIADHL
RSEDADSSVKEDWKYVAMVIDRIFLWLFIIVCFLGTIGLFLPPFLAGMI
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgggcccctcctgtcctgtgttcctgtccttcacaaagctcagcctgtggtggctcctt
ctgaccccagcaggtggagaggaagctaagcgcccacctcccagggctcctggagaccca
ctctcctctcccagtcccacggcattgccgcagggaggctcgcataccgagactgaggac
cggctcttcaaacacctcttccggggctacaaccgctgggcgcgcccggtgcccaacact
tcagacgtggtgattgtgcgctttggactgtccatcgctcagctcatcgatgtggatgag
aagaaccaaatgatgaccaccaacgtctggctaaaacaggagtggagcgactacaaactg
cgctggaaccccactgattttggcaacatcacatctctcagggtcccttctgagatgatc
tggatccccgacattgttctctacaacaatgcagatggggagtttgcagtgacccacatg
accaaggcccacctcttctccacgggcactgtgcactgggtgcccccggccatctacaag
agctcctgcagcatcgacgtcaccttcttccccttcgaccagcagaactgcaagatgaag
tttggctcctggacttatgacaaggccaagatcgacctggagcagatggagcagactgtg
gacctgaaggactactgggagagcggcgagtgggccatcgtcaatgccacgggcacctac
aacagcaagaagtacgactgctgcgccgagatctaccccgacgtcacctacgccttcgtc
atccggcggctgccgctcttctacaccatcaacctcatcatcccctgcctgctcatctcc
tgcctcactgtgctggtcttctacctgccctccgactgcggcgagaagatcacgctgtgc
atttcggtgctgctgtcactcaccgtcttcctgctgctcatcactgagatcatcccgtcc
acctcgctggtcatcccgctcatcggcgagtacctgctgttcaccatgatcttcgtcacc
ctgtccatcgtcatcaccgtcttcgtgctcaatgtgcaccaccgctcccccagcacccac
accatgccccactgggtgcggggggcccttctgggctgtgtgccccggtggcttctgatg
aaccggcccccaccacccgtggagctctgccaccccctacgcctgaagctcagcccctct
tatcactggctggagagcaacgtggatgccgaggagagggaggtggtggtggaggaggag
gacagatgggcatgtgcaggtcatgtggccccctctgtgggcaccctctgcagccacggc
cacctgcactctggggcctcaggtcccaaggctgaggctctgctgcaggagggtgagctg
ctgctatcaccccacatgcagaaggcactggaaggtgtgcactacattgccgaccacctg
cggtctgaggatgctgactcttcggtgaaggaggactggaagtatgttgccatggtcatc
gacaggatcttcctctggctgtttatcatcgtctgcttcctggggaccatcggcctcttt
ctgcctccgttcctagctggaatgatctga

KEGG   Homo sapiens (human): 1136
Entry
1136              CDS       T01001                                 
Symbol
CHRNA3, BAIPRCK, LNCR2, NACHRA3, PAOD2
Name
(RefSeq) cholinergic receptor nicotinic alpha 3 subunit
  KO
K04805  nicotinic acetylcholine receptor alpha-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06210  ERK signaling
  Element
N01344  NNK/NNN to RAS-ERK signaling pathway
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisinicline: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tebanicline tosylate: D06016
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1136 (CHRNA3)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1136 (CHRNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    1136 (CHRNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1136 (CHRNA3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1136 (CHRNA3)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD FtsK_alpha
Other DBs
NCBI-GeneID: 1136
NCBI-ProteinID: NP_000734
OMIM: 118503
HGNC: 1957
Ensembl: ENSG00000080644
Pharos: P32297(Tclin)
UniProt: P32297
Structure
LinkDB
Position
15:complement(78593052..78620996)
AA seq 505 aa
MGSGPLSLPLALSPPRLLLLLLLSLLPVARASEAEHRLFERLFEDYNEIIRPVANVSDPV
IIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPD
IVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSW
SYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
PLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLV
IPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPT
SNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLT
RSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFL
WVFTLVCILGTAGLFLQPLMAREDA
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgggctctggcccgctctcgctgcccctggcgctgtcgccgccgcggctgctgctgctg
ctgctgctgtctctgctgccagtggccagggcctcagaggctgagcaccgtctatttgag
cggctgtttgaagattacaatgagatcatccggcctgtagccaacgtgtctgacccagtc
atcatccatttcgaggtgtccatgtctcagctggtgaaggtggatgaagtaaaccagatc
atggagaccaacctgtggctcaagcaaatctggaatgactacaagctgaaatggaacccc
tctgactatggtggggcagagttcatgcgtgtccctgcacagaagatctggaagccagac
attgtgctgtataacaatgctgttggggatttccaggtggacgacaagaccaaagcctta
ctcaagtacactggggaggtgacttggatacctccggccatctttaagagctcctgtaaa
atcgacgtgacctacttcccgtttgattaccaaaactgtaccatgaagttcggttcctgg
tcctacgataaggcgaaaatcgatctggtcctgatcggctcttccatgaacctcaaggac
tattgggagagcggcgagtgggccatcatcaaagccccaggctacaaacacgacatcaag
tacaactgctgcgaggagatctaccccgacatcacatactcgctgtacatccggcgcctg
cccttgttctacaccatcaacctcatcatcccctgcctgctcatctccttcctcactgtg
ctcgtcttctacctgccctccgactgcggtgagaaggtgaccctgtgcatttctgtcctc
ctctccctgacggtgtttctcctggtgatcactgagaccatcccttccacctcgctggtc
atccccctgattggagagtacctcctgttcaccatgatttttgtaaccttgtccatcgtc
atcaccgtcttcgtgctcaacgtgcactacagaaccccgacgacacacacaatgccctca
tgggtgaagactgtattcttgaacctgctccccagggtcatgttcatgaccaggccaaca
agcaacgagggcaacgctcagaagccgaggcccctctacggtgccgagctctcaaatctg
aattgcttcagccgcgcagagtccaaaggctgcaaggagggctacccctgccaggacggg
atgtgtggttactgccaccaccgcaggataaaaatctccaatttcagtgctaacctcacg
agaagctctagttctgaatctgttgatgctgtgctgtccctctctgctttgtcaccagaa
atcaaagaagccatccaaagtgtcaagtatattgctgaaaatatgaaagcacaaaatgaa
gccaaagagattcaagatgattggaagtatgttgccatggtgattgatcgtatttttctg
tgggttttcaccctggtgtgcattctagggacagcaggattgtttctgcaacccctgatg
gccagggaagatgcataa

KEGG   Homo sapiens (human): 1137
Entry
1137              CDS       T01001                                 
Symbol
CHRNA4, BFNC, EBN, EBN1, NACHR, NACHRA4, NACRA4
Name
(RefSeq) cholinergic receptor nicotinic alpha 4 subunit
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05033  Nicotine addiction
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06210  ERK signaling
nt06219  JAK-STAT signaling
  Element
N01342  Nicotine to Jak-STAT signaling pathway
N01344  NNK/NNN to RAS-ERK signaling pathway
Disease
H00807  Nocturnal frontal lobe epilepsy
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Altinicline maleate: D02839
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisinicline: D07770
Dexmecamylamine (DG01378): D10111 D10112
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Ispronicline: D08935
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Pozanicline (DG01288): D09367 D09368
Rivanicline galactarate: D08987
Rocuronium bromide: D00765<JP/US>
Sofinicline (DG01286): D09382 D09383
Tebanicline tosylate: D06016
Tubocurarine (DG00767): D02207 D08655
Varenicline (DG00995): D06282<JP/US> D08669
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1137 (CHRNA4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1137 (CHRNA4)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    1137 (CHRNA4)
  09165 Substance dependence
   05033 Nicotine addiction
    1137 (CHRNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1137 (CHRNA4)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1137 (CHRNA4)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD Blt1
Other DBs
NCBI-GeneID: 1137
NCBI-ProteinID: NP_000735
OMIM: 118504
HGNC: 1958
Ensembl: ENSG00000101204
Pharos: P43681(Tclin)
UniProt: P43681 B4DK78 Q59FV0
Structure
LinkDB
Position
20:complement(63343223..63361349)
AA seq 627 aa
MELGGPGAPRLLPPLLLLLGTGLLRASSHVETRAHAEERLLKKLFSGYNKWSRPVANISD
VVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWR
PDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFG
SWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIR
RLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTS
LVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKR
PSVVKDNCRRLIESMHKMASAPRFWPEPEGEPPATSGTQSLHPPSPSFCVPLDVPAEPGP
SCKSPSDQLPPQQPLEAEKASPHPSPGPCRPPHGTQAPGLAKARSLSVQHMSSPGEAVEG
GVRCRSRSIQYCVPRDDAAPEADGQAAGALASRNTHSAELPPPDQPSPCKCTCKKEPSSV
SPSATVKTRSTKAPPPHLPLSPALTRAVEGVQYIADHLKAEDTDFSVKEDWKYVAMVIDR
IFLWMFIIVCLLGTVGLFLPPWLAGMI
NT seq 1884 nt   +upstreamnt  +downstreamnt
atggagctagggggccccggagcgccgcggctgctgccgccgctgctgctgcttctgggg
accggcctcctgcgcgccagcagccatgtggagacccgggcccacgccgaggagcggctc
ctgaagaaactcttctccggttacaacaagtggtcccgacccgtggccaacatctcggac
gtggtcctcgtccgcttcggcctgtccatcgctcagctcattgacgtggatgagaagaac
cagatgatgaccacgaacgtatgggtgaagcaggagtggcacgactacaagctgcgctgg
gacccagctgactatgagaatgtcacctccatccgcatcccctccgagctcatctggcgg
ccggacatcgtcctctacaacaatgctgacggggacttcgcggtcacccacctgaccaag
gcccacctgttccatgacgggcgggtgcagtggactcccccggccatttacaagagctcc
tgcagcatcgacgtcaccttcttccccttcgaccagcagaactgcaccatgaaattcggc
tcctggacctacgacaaggccaagatcgacctggtgaacatgcacagccgcgtggaccag
ctggacttctgggagagtggcgagtgggtcatcgtggatgccgtgggcacctacaacacc
aggaagtacgagtgctgtgccgagatctacccggacatcacctatgccttcgtcatccgg
cggctgccgctcttctacaccatcaacctcatcatcccctgcctgctcatctcctgcctc
accgtgctggtcttctacctgccctccgagtgtggcgagaagatcacgctgtgcatctcc
gtgctgctgtcgctcaccgtcttcctgctgctcatcaccgagatcatcccgtccacctca
ctggtcatcccactcatcggcgagtacctgctgttcaccatgatcttcgtcaccctgtcc
atcgtcatcacggtcttcgtgctcaacgtgcaccaccgctcgccacgcacgcacaccatg
cccacctgggtacgcagggtcttcctggacatcgtgccacgcctgctcctcatgaagcgg
ccgtccgtggtcaaggacaattgccggcggctcatcgagtccatgcataagatggccagt
gccccgcgcttctggcccgagccagaaggggagccccctgccacgagcggcacccagagc
ctgcacccgccctcaccgtccttctgtgtccccctggatgtgccggctgagcctgggcct
tcctgcaagtcaccctccgaccagctccctcctcagcagcccctggaagctgagaaagcc
agcccccacccctcgcctggaccctgccgcccgccccacggcacccaggcaccagggctg
gccaaagccaggtccctcagcgtccagcacatgtccagccctggcgaagcggtggaaggc
ggcgtccggtgccggtctcggagcatccagtactgtgttccccgagacgatgccgccccc
gaggcagatggccaggctgccggcgccctggcctctcgcaacacccactcggctgagctc
ccacccccagaccagccctctccgtgcaaatgcacatgcaagaaggagccctcttcggtg
tccccgagcgccacggtcaagacccgcagcaccaaagcgccgcccccgcacctgcccctg
tcgccggccctgacccgggcggtggagggcgtccagtacattgcagaccacctgaaggcc
gaagacacagacttctcggtgaaggaggactggaagtacgtggccatggtcatcgaccgc
atcttcctctggatgttcatcatcgtctgcctgctggggacggtgggcctcttcctgccg
ccctggctggctggcatgatctag

KEGG   Homo sapiens (human): 1138
Entry
1138              CDS       T01001                                 
Symbol
CHRNA5, LNCR2
Name
(RefSeq) cholinergic receptor nicotinic alpha 5 subunit
  KO
K04807  nicotinic acetylcholine receptor alpha-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisinicline: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1138 (CHRNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1138 (CHRNA5)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1138 (CHRNA5)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb Cadherin_5
Other DBs
NCBI-GeneID: 1138
NCBI-ProteinID: NP_000736
OMIM: 118505
HGNC: 1959
Ensembl: ENSG00000169684
Pharos: P30532(Tbio)
UniProt: P30532 Q6EWN4
LinkDB
Position
15:78565520..78595269
AA seq 468 aa
MAARGSGPRALRLLLLVQLVAGRCGLAGAAGGAQRGLSEPSSIAKHEDSLLKDLFQDYER
WVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKV
IRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFD
LQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYV
TYSFVIKRLPLFYTLFLIIPCIGLSFLTVLVFYLPSNEGEKICLCTSVLVSLTVFLLVIE
EIIPSSSKVIPLIGEYLVFTMIFVTLSIMVTVFAINIHHRSSSTHNAMAPLVRKIFLHTL
PKLLCMRSHVDRYFTQKEETESGSGPKSSRNTLEAALDSIRYITRHIMKENDVREVVEDW
KFIAQVLDRMFLWTFLFVSIVGSLGLFVPVIYKWANILIPVHIGNANK
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggcggcgcgggggtcagggccccgcgcgctccgcctgctgctcttggtccagctggtc
gcggggcgctgcggtctagcgggcgcggcgggcggcgcgcagagaggattatctgaacct
tcttctattgcaaaacatgaagatagtttgcttaaggatttatttcaagactacgaaaga
tgggttcgtcctgtggaacacctgaatgacaaaataaaaataaaatttggacttgcaata
tctcaattggtggatgtggatgagaaaaatcagttaatgacaacaaacgtctggttgaaa
caggaatggatagatgtaaaattaagatggaaccctgatgactatggtggaataaaagtt
atacgtgttccttcagactctgtctggacaccagacatcgttttgtttgataatgcagat
ggacgttttgaagggaccagtacgaaaacagtcatcaggtacaatggcactgtcacctgg
actccaccggcaaactacaaaagttcctgtaccatagatgtcacgtttttcccatttgac
cttcagaactgttccatgaaatttggttcttggacttatgatggatcacaggttgatata
attctagaggaccaagatgtagacaagagagatttttttgataatggagaatgggagatt
gtgagtgcaacagggagcaaaggaaacagaaccgacagctgttgctggtatccgtatgtc
acttactcatttgtaatcaagcgcctgcctctcttttataccttgttccttataataccc
tgtattgggctctcatttttaactgtacttgtcttctatcttccttcaaatgaaggtgaa
aagatttgtctctgcacttcagtacttgtgtctttgactgtcttccttctggttattgaa
gagatcataccatcatcttcaaaagtcatacctctaattggagagtatctggtatttacc
atgatttttgtgacactgtcaattatggtaaccgtcttcgctatcaacattcatcatcgt
tcttcctcaacacataatgccatggcgcctttggtccgcaagatatttcttcacacgctt
cccaaactgctttgcatgagaagtcatgtagacaggtacttcactcagaaagaggaaact
gagagtggtagtggaccaaaatcttctagaaacacattggaagctgcgctcgattctatt
cgctacattacaagacacatcatgaaggaaaatgatgtccgtgaggttgttgaagattgg
aaattcatagcccaggttcttgatcggatgtttctgtggacttttcttttcgtttcaatt
gttggatctcttgggctttttgttcctgttatttataaatgggcaaatatattaatacca
gttcatattggaaatgcaaataagtga

KEGG   Homo sapiens (human): 1139
Entry
1139              CDS       T01001                                 
Symbol
CHRNA7, CHRNA7-2, NACHRA7
Name
(RefSeq) cholinergic receptor nicotinic alpha 7 subunit
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05033  Nicotine addiction
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06219  JAK-STAT signaling
nt06230  Cell cycle
nt06418  Oxidative phosphorylation
nt06419  Microtubule-based transport
nt06460  Alzheimer disease
  Element
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N01018  Mutation-caused aberrant Abeta to anterograde axonal transport
N01336  CHRNA7-E2F signaling pathway
N01337  NNK/NNN to CHRNA7-E2F signaling pathway
N01338  ACH-CHRN-PI3K signaling pathway
N01339  NNK/NNN to PI3K signaling pathway
N01340  ACH-CHRN-JAK-STAT signaling pathway
N01341  NNK/NNN to Jak-STAT signaling pathway
N01343  ACH-CHRN-RAS-ERK signaling pathway
N01344  NNK/NNN to RAS-ERK signaling pathway
N01349  ACH-CHRN-PI3K signaling pathway
Disease
H01877  Chromosome 15q13.3 microdeletion syndrome
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Bradanicline (DG01849): D10613 D10693
Cisatracurium: D00759<US>
Cytisinicline: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Encenicline (DG01852): D10626 D10702 D10789
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1139 (CHRNA7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1139 (CHRNA7)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1139 (CHRNA7)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    1139 (CHRNA7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1139 (CHRNA7)
   05022 Pathways of neurodegeneration - multiple diseases
    1139 (CHRNA7)
  09165 Substance dependence
   05033 Nicotine addiction
    1139 (CHRNA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1139 (CHRNA7)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1139 (CHRNA7)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb SUR7
Other DBs
NCBI-GeneID: 1139
NCBI-ProteinID: NP_000737
OMIM: 118511
HGNC: 1960
Ensembl: ENSG00000175344
UniProt: P36544
Structure
LinkDB
Position
15:32030483..32173018
AA seq 502 aa
MRCSPGGVWLALAASLLHVSLQGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDL
QMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHK
QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHL
LHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgcgctgctcgccgggaggcgtctggctggcgctggccgcgtcgctcctgcacgtgtcc
ctgcaaggcgagttccagaggaagctttacaaggagctggtcaagaactacaatcccttg
gagaggcccgtggccaatgactcgcaaccactcaccgtctacttctccctgagcctcctg
cagatcatggacgtggatgagaagaaccaagttttaaccaccaacatttggctgcaaatg
tcttggacagatcactatttacagtggaatgtgtcagaatatccaggggtgaagactgtt
cgtttcccagatggccagatttggaaaccagacattcttctctataacagtgctgatgag
cgctttgacgccacattccacactaacgtgttggtgaattcttctgggcattgccagtac
ctgcctccaggcatattcaagagttcctgctacatcgatgtacgctggtttccctttgat
gtgcagcactgcaaactgaagtttgggtcctggtcttacggaggctggtccttggatctg
cagatgcaggaggcagatatcagtggctatatccccaatggagaatgggacctagtggga
atccccggcaagaggagtgaaaggttctatgagtgctgcaaagagccctaccccgatgtc
accttcacagtgaccatgcgccgcaggacgctctactatggcctcaacctgctgatcccc
tgtgtgctcatctccgccctcgccctgctggtgttcctgcttcctgcagattccggggag
aagatttccctggggataacagtcttactctctcttaccgtcttcatgctgctcgtggct
gagatcatgcccgcaacatccgattcggtaccattgatagcccagtacttcgccagcacc
atgatcatcgtgggcctctcggtggtggtgacagtgatcgtgctgcagtaccaccaccac
gaccccgacgggggcaagatgcccaagtggaccagagtcatccttctgaactggtgcgcg
tggttcctgcgaatgaagaggcccggggaggacaaggtgcgcccggcctgccagcacaag
cagcggcgctgcagcctggccagtgtggagatgagcgccgtggcgccgccgcccgccagc
aacgggaacctgctgtacatcggcttccgcggcctggacggcgtgcactgtgtcccgacc
cccgactctggggtagtgtgtggccgcatggcctgctcccccacgcacgatgagcacctc
ctgcacggcgggcaaccccccgagggggacccggacttggccaagatcctggaggaggtc
cgctacattgccaaccgcttccgctgccaggacgaaagcgaggcggtctgcagcgagtgg
aagttcgccgcctgtgtggtggaccgcctgtgcctcatggccttctcggtcttcaccatc
atctgcaccatcggcatcctgatgtcggctcccaacttcgtggaggccgtgtccaaagac
tttgcgtaa

KEGG   Homo sapiens (human): 1140
Entry
1140              CDS       T01001                                 
Symbol
CHRNB1, ACHRB, CHRNB, CMS1D, CMS2A, CMS2C, SCCMS
Name
(RefSeq) cholinergic receptor nicotinic beta 1 subunit
  KO
K04812  nicotinic acetylcholine receptor beta-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00770  Congenital myasthenic syndrome
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Cytisinicline: D07770
Gantacurium chloride: D04303
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Metocurine iodide: D00761
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Suxamethonium (DG00768): D00766<US> D02275<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1140 (CHRNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1140 (CHRNB1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1140 (CHRNB1)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Other DBs
NCBI-GeneID: 1140
NCBI-ProteinID: NP_000738
OMIM: 100710
HGNC: 1961
Ensembl: ENSG00000170175
Pharos: P11230(Tclin)
UniProt: P11230
LinkDB
Position
17:7445061..7457710
AA seq 501 aa
MTPGALLMLLGALGAPLAPGVRGSEAEGRLREKLFSGYDSSVRPAREVGDRVRVSVGLIL
AQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIDSLRITAESVWLPDVVLLNNND
GNFDVALDISVVVSSDGSVRWQPPGIYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVS
LQTGLGPDGQGHQEIHIHEGTFIENGQWEIIHKPSRLIQPPGDPRGGREGQRQEVIFYLI
IRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPE
TSLSVPIIIKYLMFTMVLVTFSVILSVVVLNLHHRSPHTHQMPLWVRQIFIHKLPLYLRL
KRPKPERDLMPEPPHCSSPGSGWGRGTDEYFIRKPPSDFLFPKPNRFQPELSAPDLRRFI
DGPNRAVALLPELREVVSSISYIARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIIFTS
VGTLVIFLDATYHLPPPDPFP
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgaccccaggggctctgctgatgctgctgggggcgctgggggcgccgctcgccccaggc
gtccgcggctcggaggcggagggtcgactccgggagaaacttttctctggctatgatagc
tccgtgcggccagcgcgggaggtgggagaccgtgtcagggtcagcgttggtctcatcctg
gcgcaactcatcagcctgaacgagaaggatgaagagatgagcacaaaggtgtacttagac
ctggagtggactgactacaggctgagctgggaccctgcggagcacgacggcatcgattcg
ctccgcatcacggcggaatccgtgtggctccctgacgtggtgctactgaacaacaatgat
gggaattttgacgtggctctggacattagcgtcgtggtgtcctccgacggctccgtgcgt
tggcaacccccgggcatctatcgcagcagctgcagcatccaggtcacctacttccccttc
gactggcagaattgcactatggtgttcagctcctacagctacgacagctcggaggtcagc
ctgcagacaggcctgggtcctgacgggcaagggcatcaggaaatccacattcatgaaggg
actttcattgagaatggccagtgggagattatccacaagccctctcggctaatccagcct
ccaggcgatcctaggggagggagggaaggacagcgccaggaagtcatcttctacctcatc
atccgccgcaagcctctcttctacctggtcaacgtcattgccccatgcatcctcatcact
cttctggccatcttcgtcttctacctgccaccagatgcaggagagaagatggggctctca
atctttgccctgctgacccttactgtgttcctgctgctgctggctgacaaagtacctgag
acctcactatcagtacccattattatcaagtacctcatgtttaccatggtcctcgtcacc
ttctcagtcatccttagtgtcgtggttctcaacctgcaccaccgctcaccccacacccac
caaatgcccctttgggtccgtcagatcttcattcacaaacttccgctgtacctgcgtcta
aaaaggcccaaacccgagagagacctgatgccggagccccctcactgttcttctccagga
agtggctggggtcggggaacagatgaatatttcatccggaagccgccaagtgattttctc
ttccccaaacccaataggttccagcctgaactgtctgcccctgatctgcggcgatttatc
gatggtccaaaccgggctgtggccctgcttccggagctacgggaggtcgtctcctctatc
agctacatcgctcgacagctgcaggaacaggaggaccacgatgcgctgaaggaggactgg
cagtttgtggccatggtagtggaccgcctcttcctgtggactttcatcatcttcaccagc
gttgggaccctagtcatcttcctggacgccacgtaccacttgccccctccagaccccttt
ccttga

KEGG   Homo sapiens (human): 1141
Entry
1141              CDS       T01001                                 
Symbol
CHRNB2, EFNL3, nAChRB2
Name
(RefSeq) cholinergic receptor nicotinic beta 2 subunit
  KO
K04813  nicotinic acetylcholine receptor beta-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05033  Nicotine addiction
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06210  ERK signaling
nt06219  JAK-STAT signaling
  Element
N01342  Nicotine to Jak-STAT signaling pathway
N01344  NNK/NNN to RAS-ERK signaling pathway
Disease
H00807  Nocturnal frontal lobe epilepsy
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Altinicline maleate: D02839
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisinicline: D07770
Dexmecamylamine (DG01378): D10111 D10112
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Ispronicline: D08935
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Pozanicline (DG01288): D09367 D09368
Rivanicline galactarate: D08987
Rocuronium bromide: D00765<JP/US>
Sofinicline (DG01286): D09382 D09383
Tebanicline tosylate: D06016
Tubocurarine (DG00767): D02207 D08655
Varenicline (DG00995): D06282<JP/US> D08669
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1141 (CHRNB2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1141 (CHRNB2)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    1141 (CHRNB2)
  09165 Substance dependence
   05033 Nicotine addiction
    1141 (CHRNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1141 (CHRNB2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1141 (CHRNB2)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Other DBs
NCBI-GeneID: 1141
NCBI-ProteinID: NP_000739
OMIM: 118507
HGNC: 1962
Ensembl: ENSG00000160716
Pharos: P17787(Tclin)
UniProt: P17787 Q5SXY3
Structure
LinkDB
Position
1:154567778..154580013
AA seq 502 aa
MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL
MVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLY
NNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDR
TEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTIN
LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY
LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQR
LRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPC
GCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ
PLFQNYTTTTFLHSDHSAPSSK
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggcccggcgctgcggccccgtggcgctgctccttggcttcggcctcctccggctgtgc
tcaggggtgtggggtacggatacagaggagcggctggtggagcatctcctggatccttcc
cgctacaacaagcttatccgcccagccaccaatggctctgagctggtgacagtacagctt
atggtgtcactggcccagctcatcagtgtgcatgagcgggagcagatcatgaccaccaat
gtctggctgacccaggagtgggaagattatcgcctcacctggaagcctgaagagtttgac
aacatgaagaaagttcggctcccttccaaacacatctggctcccagatgtggtcctgtac
aacaatgctgacggcatgtacgaggtgtccttctattccaatgccgtggtctcctatgat
ggcagcatcttctggctgccgcctgccatctacaagagcgcatgcaagattgaagtaaag
cacttcccatttgaccagcagaactgcaccatgaagttccgttcgtggacctacgaccgc
acagagatcgacttggtgctgaagagtgaggtggccagcctggacgacttcacacctagt
ggtgagtgggacatcgtggcgctgccgggccggcgcaacgagaaccccgacgactctacg
tacgtggacatcacgtatgacttcatcattcgccgcaagccgctcttctacaccatcaac
ctcatcatcccctgtgtgctcatcacctcgctagccatccttgtcttctacctgccatcc
gactgtggcgagaagatgacgttgtgcatctcagtgctgctggcgctcacggtcttcctg
ctgctcatctccaagatcgtgcctcccacctccctcgacgtgccgctcgtcggcaagtac
ctcatgttcaccatggtgcttgtcaccttctccatcgtcaccagcgtgtgcgtgctcaac
gtgcaccaccgctcgcccaccacgcacaccatggcgccctgggtgaaggtcgtcttcctg
gagaagctgcccgcgctgctcttcatgcagcagccacgccatcattgcgcccgtcagcgc
ctgcgcctgcggcgacgccagcgtgagcgcgagggcgctggagccctcttcttccgcgaa
gccccaggggccgactcctgcacgtgcttcgtcaaccgcgcgtcggtgcaggggttggcc
ggggccttcggggctgagcctgcaccagtggcgggccccgggcgctcaggggagccgtgt
ggctgtggcctccgggaggcggtggacggcgtgcgcttcatcgcagaccacatgcggagc
gaggacgatgaccagagcgtgagtgaggactggaagtacgtcgccatggtgatcgaccgc
ctcttcctctggatctttgtctttgtctgtgtctttggcaccatcggcatgttcctgcag
cctctcttccagaactacaccaccaccaccttcctccactcagaccactcagcccccagc
tccaagtga

KEGG   Homo sapiens (human): 1142
Entry
1142              CDS       T01001                                 
Symbol
CHRNB3
Name
(RefSeq) cholinergic receptor nicotinic beta 3 subunit
  KO
K04814  nicotinic acetylcholine receptor beta-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisinicline: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1142 (CHRNB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1142 (CHRNB3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1142 (CHRNB3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF3945 PepSY_TM
Other DBs
NCBI-GeneID: 1142
NCBI-ProteinID: NP_000740
OMIM: 118508
HGNC: 1963
Ensembl: ENSG00000147432
Pharos: Q05901(Tchem)
UniProt: Q05901
LinkDB
Position
8:42697366..42737407
AA seq 458 aa
MLPDFMLVLIVLGIPSSATTGFNSIAENEDALLRHLFQGYQKWVRPVLHSNDTIKVYFGL
KISQLVDVDEKNQLMTTNVWLKQEWTDHKLRWNPDDYGGIHSIKVPSESLWLPDIVLFEN
ADGRFEGSLMTKVIVKSNGTVVWTPPASYKSSCTMDVTFFPFDRQNCSMKFGSWTYDGTM
VDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITYSFVLRRLPLFYTLFL
IIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYL
LFIMIFVTLSIIVTVFVINVHHRSSSTYHPMAPWVKRLFLQKLPKLLCMKDHVDRYSSPE
KEESQPVVKGKVLEKKKQKQLSDGEKVLVAFLEKAADSIRYISRHVKKEHFISQVVQDWK
FVAQVLDRIFLWLFLIVSVTGSVLIFTPALKMWLHSYH
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgctcccagattttatgctggttctcatcgtccttggcatcccttcctcagccaccaca
ggtttcaactcaatcgccgaaaatgaagatgccctcctcagacatttgttccaaggttat
cagaaatgggtccgccctgtattacattctaatgacaccataaaagtatattttggattg
aaaatatcccagcttgtagatgtggatgaaaagaatcagctgatgacaaccaatgtgtgg
ctcaaacaggaatggacagaccacaagttacgctggaatcctgatgattatggtgggatc
cattccattaaagttccatcagaatctctgtggcttcctgacatagttctctttgaaaat
gctgacggccgcttcgaaggctccctgatgaccaaggtcatcgtgaaatcaaacggaact
gttgtctggacccctcccgccagctacaaaagctcctgcaccatggacgtcacgtttttc
ccgttcgaccgacagaactgctccatgaagtttggatcctggacttatgatggcaccatg
gttgacctcattttgatcaatgaaaatgtcgacagaaaagacttcttcgataacggagaa
tgggaaatactgaacgcaaaggggatgaaggggaacagaagggacggcgtgtactcctat
ccctttatcacgtattccttcgtcctgagacgcctgcctttattctataccctctttctc
atcatcccctgcctggggctgtctttcctaacagttcttgtgttctatttaccttcggat
gaaggagaaaaactttcattatccacatcggtcttggtttctctgacagttttcctttta
gtgattgaagaaatcatcccatcgtcttccaaagtcattcctctcattggagagtacctg
ctgttcatcatgatttttgtgaccctgtccatcattgttaccgtgtttgtcattaacgtt
caccacagatcttcttccacgtaccaccccatggccccctgggttaagaggctctttctg
cagaaacttccaaaattactttgcatgaaagatcatgtggatcgctactcatccccagag
aaagaggagagtcaaccagtagtgaaaggcaaagtcctcgaaaaaaagaaacagaaacag
cttagtgatggagaaaaagttctagttgcttttttggaaaaagctgctgattccattaga
tacatttcgagacatgtgaagaaagaacattttatcagccaggtagtacaagactggaaa
tttgtagctcaagttcttgaccgaatcttcctgtggctctttctgatagtgtcagtaaca
ggctcggttctgatttttacccctgctttgaagatgtggctacatagttaccattag

KEGG   Homo sapiens (human): 1143
Entry
1143              CDS       T01001                                 
Symbol
CHRNB4
Name
(RefSeq) cholinergic receptor nicotinic beta 4 subunit
  KO
K04815  nicotinic acetylcholine receptor beta-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04725  Cholinergic synapse
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06210  ERK signaling
  Element
N01344  NNK/NNN to RAS-ERK signaling pathway
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisinicline: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tebanicline tosylate: D06016
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1143 (CHRNB4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    1143 (CHRNB4)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    1143 (CHRNB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1143 (CHRNB4)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   1143 (CHRNB4)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Other DBs
NCBI-GeneID: 1143
NCBI-ProteinID: NP_000741
OMIM: 118509
HGNC: 1964
Ensembl: ENSG00000117971
Pharos: P30926(Tclin)
UniProt: P30926
Structure
LinkDB
Position
15:complement(78624111..78661641)
AA seq 498 aa
MRRAPSLVLFFLVALCGRGNCRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQL
SLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNN
ADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTE
IDMVLMTPTASMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLI
IPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLM
FTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRPGPDSSPARAF
PPSKSCVTKPEATATSTSPSNFYGNSMYFVNPASAASKSPAGSTPVAIPRDFWLRSSGRF
RQDVQEALEGVSFIAQHMKNDDEDQSVVEDWKYVAMVVDRLFLWVFMFVCVLGTVGLFLP
PLFQTHAASEGPYAAQRD
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgaggcgcgcgccttccctggtccttttcttcctggtcgccctttgcgggcgcgggaac
tgccgcgtggccaatgcggaggaaaagctgatggacgaccttctgaacaaaacccgttac
aataacctgatccgcccagccaccagctcctcacagctcatctccatcaagctgcagctc
tccctggcccagcttatcagcgtgaatgagcgagagcagatcatgaccaccaatgtctgg
ctgaaacaggaatggactgattaccgcctgacctggaacagctcccgctacgagggtgtg
aacatcctgaggatccctgcaaagcgcatctggttgcctgacatcgtgctttacaacaac
gccgacgggacctatgaggtgtctgtctacaccaacttgatagtccggtccaacggcagc
gtcctgtggctgccccctgccatctacaagagcgcctgcaagattgaggtgaagtacttt
cccttcgaccagcagaactgcaccctcaagttccgctcctggacctatgaccacacggag
atagacatggtcctcatgacgcccacagccagcatggatgactttactcccagtggtgag
tgggacatagtggccctcccagggagaaggacagtgaacccacaagaccccagctacgtg
gacgtgacttacgacttcatcatcaagcgcaagcctctgttctacaccatcaacctcatc
atcccctgcgtgctcaccaccttgctggccatcctcgtcttctacctgccatccgactgc
ggcgagaagatgacactgtgcatctcagtgctgctggcactgacattcttcctgctgctc
atctccaagatcgtgccacccacctccctcgatgtgcctctcatcggcaagtacctcatg
ttcaccatggtgctggtcaccttctccatcgtcaccagcgtctgtgtgctcaatgtgcac
caccgctcgcccagcacccacaccatggcaccctgggtcaagcgctgcttcctgcacaag
ctgcctaccttcctcttcatgaagcgccctggccccgacagcagcccggccagagccttc
ccgcccagcaagtcatgcgtgaccaagcccgaggccaccgccacctccaccagcccctcc
aacttctatgggaactccatgtactttgtgaaccccgcctctgcagcttccaagtctcca
gccggctctaccccggtggctatccccagggatttctggctgcggtcctctgggaggttc
cgacaggatgtgcaggaggcattagaaggtgtcagcttcatcgcccagcacatgaagaat
gacgatgaagaccagagtgtcgttgaggactggaagtacgtggctatggtggtggaccgg
ctgttcctgtgggtgttcatgtttgtgtgcgtcctgggcactgtggggctcttcctaccg
cccctcttccagacccatgcagcttctgaggggccctacgctgcccagcgtgactga

DBGET integrated database retrieval system