KEGG   Homo sapiens (human): 115653
Entry
115653            CDS       T01001                                 
Symbol
KIR3DL3, CD158Z, KIR3DL7, KIR44, KIRC1
Name
(RefSeq) killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    115653 (KIR3DL3)
   04612 Antigen processing and presentation
    115653 (KIR3DL3)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    115653 (KIR3DL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    115653 (KIR3DL3)
CD molecules [BR:hsa04090]
 Proteins
  115653 (KIR3DL3)
SSDB
Motif
Pfam: ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 115653
NCBI-ProteinID: NP_703144
OMIM: 610095
HGNC: 16312
Ensembl: ENSG00000242019
UniProt: Q8N743
LinkDB
Position
19:54724442..54736632
AA seq 410 aa
MSLMVVSMACVGFFLLEGPWPHVGGQDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSL
SKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGV
HRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNY
SMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENV
TLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRAL
PHAWSDPSDPLPVSVTGNSRNLHVLIGTSVVIIPFAILLFFLLHRWCANKKNAVVMDQEP
AGNRTVNREDSDEQDPQEVTYAQLNHCVFTQRKITRPSQRPKTPPTDTSV
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggcgtgtgttgggttcttcttgctggaggggccctgg
ccacatgtgggtggtcaggacaagcccttcctctctgcctggcccggcactgtggtgtct
gaaggacaacatgtgactcttcagtgtcgctctcgtcttgggtttaatgaattcagtctg
tccaaagaagacgggatgcctgtccctgagctctacaacagaatattccggaacagcttt
ctcatgggccctgtgaccccagcacatgcagggacctacagatgttgcagttcacaccca
cactcccccactgggtggtcggcacccagcaaccctgtggtgatcatggtcacaggagtc
cacagaaaaccttccctcctggcccacccaggtcccctggtgaaatcaggagagacggtc
atcctgcaatgttggtcagatgtcaggtttgagcgcttccttctgcacagagaggggatc
actgaggaccccttgcgcctcgttggacagctccacgatgcgggttcccaggtcaactat
tccatgggtcccatgacacctgcccttgcagggacctacagatgctttggttctgtcact
cacttaccctatgagttgtcggctcccagtgaccctctggacatcgtggtcgtaggtcta
tatgggaaaccttctctctcagcccagccgggccccacggttcaggcaggagagaatgtg
accttgtcctgcagctcccggagcttgtttgacatttaccatctatccagggaggcggag
gccggtgaacttaggctcactgcagtgctgagggtcaatggaacattccaggccaacttc
cctctgggccctgtgacccacggagggaactacagatgcttcggctctttccgtgccctg
ccccatgcgtggtcagacccgagtgacccactgcccgtttctgtcacaggtaactccaga
aacctgcacgttctgattgggacctcagtggtcatcatcccctttgctatcctcctcttc
tttctccttcatcgctggtgtgccaacaaaaagaatgctgttgtaatggaccaagagcct
gcagggaacagaacagtgaacagggaggactctgatgaacaagaccctcaggaggtgaca
tacgcacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttctcagagg
cccaagacacccccaacagataccagcgtgtaa

KEGG   Homo sapiens (human): 3802
Entry
3802              CDS       T01001                                 
Symbol
KIR2DL1, CD158A, KIR-K64, KIR221, KIR2DL3, NKAT, NKAT-1, NKAT1, p58.1
Name
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 1
  KO
K07981  killer cell immunoglobulin-like receptor 2DL1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Drug target
Lirilumab: D10444
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3802 (KIR2DL1)
   04612 Antigen processing and presentation
    3802 (KIR2DL1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3802 (KIR2DL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3802 (KIR2DL1)
CD molecules [BR:hsa04090]
 Proteins
  3802 (KIR2DL1)
SSDB
Motif
Pfam: ig Ig_2 Ig_3
Other DBs
NCBI-GeneID: 3802
NCBI-ProteinID: NP_055033
OMIM: 604936
HGNC: 6329
Ensembl: ENSG00000125498
Pharos: P43626(Tbio)
UniProt: P43626 Q6H2H2 Q6H2H3
Structure
LinkDB
Position
19:54769793..54784322
AA seq 348 aa
MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
HREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDI
VIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGT
FQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEV
TYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgtcgctcttggtcgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcgcctggtgaaa
tcagaagagacagtcatcctgcagtgttggtcagatgtcatgtttgaacacttccttctg
cacagagaggggatgtttaacgacactttgcgcctcattggagaacaccatgatggggtc
tccaaggccaacttctccatcagtcgcatgacgcaagacctggcagggacctacagatgc
tacggttctgttactcactccccctatcaggtgtcagctcccagtgaccctctggacatc
gtgatcataggtctatatgagaaaccttctctctcagcccagctgggccccacggttctg
gcaggagagaatgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggaaggggaggcccatgaacgtaggctccctgcagggcccaaggtcaacggaaca
ttccaggctgactttcctctgggccctgccacccacggagggacctacagatgcttcggc
tctttccatgactctccatacgagtggtcaaagtcaagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccaaaaccggtaac
ccccgacacctgcacattctgattgggacctcagtggtcatcatcctcttcatcctcctc
ttctttctccttcatcgctggtgctccaacaaaaaaaatgctgcggtaatggaccaagag
tctgcaggaaacagaacagcgaatagcgaggactctgatgaacaagaccctcaggaggtg
acatacacacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttctcag
aggcccaagacacccccaacagatatcatcgtgtacacggaacttccaaatgctgagtcc
agatccaaagttgtctcctgcccatga

KEGG   Homo sapiens (human): 3803
Entry
3803              CDS       T01001                                 
Symbol
KIR2DL2, CD158B1, CD158b, NKAT-6, NKAT6, p58.2
Name
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 2
  KO
K07981  killer cell immunoglobulin-like receptor 2DL1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Drug target
Lirilumab: D10444
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3803 (KIR2DL2)
   04612 Antigen processing and presentation
    3803 (KIR2DL2)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3803 (KIR2DL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3803 (KIR2DL2)
CD molecules [BR:hsa04090]
 Proteins
  3803 (KIR2DL2)
SSDB
Motif
Pfam: ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 3803
NCBI-ProteinID: NP_055034
OMIM: 604937
HGNC: 6330
Pharos: P43627(Tdark)
UniProt: P43627 Q6H2H0 Q8N742
Structure
LinkDB
Position
19q13.4
AA seq 348 aa
MSLMVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLL
HREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGT
FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSKTGN
PRHLHILIGTSVVIILFILLFFLLHRWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEV
TYTQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAESRSKVVSCP
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcgcctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcaggtttgagcacttccttctg
cacagagaagggaagtttaaggacactttgcacctcattggagagcaccatgatggggtc
tccaaagccaacttctccatcggtcccatgatgcaagaccttgcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagctcccagtgaccctctggacatc
gtcatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagagcgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggagggggaggcccatgaatgtaggttctctgcagggcccaaggtcaacggaaca
ttccaggccgactttcctctgggccctgccacccacggaggaacctacagatgcttcggc
tctttccgtgactctccatacgagtggtcaaactcgagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctctaaaaccggtaac
ccccgacacctgcacattctgattgggacctcagtggtcatcatcctcttcatcctcctc
ttctttctccttcatcgctggtgctccaacaaaaaaaatgctgcggtaatggaccaagag
tctgcagggaacagaacagcgaatagcgaggactctgatgaacaagaccctcaggaggtg
acatacacacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttctcag
aggcccaagacacccccaacagatatcatcgtgtacacggaacttccaaatgctgagtcc
agatccaaagttgtctcctgcccatga

KEGG   Homo sapiens (human): 3804
Entry
3804              CDS       T01001                                 
Symbol
KIR2DL3, CD158B2, CD158b, GL183, KIR-023GB, KIR-K7b, KIR-K7c, KIR2DL, KIR2DS5, KIRCL23, NKAT, NKAT2, NKAT2A, NKAT2B, p58
Name
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 3
  KO
K07981  killer cell immunoglobulin-like receptor 2DL1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Drug target
Lirilumab: D10444
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3804 (KIR2DL3)
   04612 Antigen processing and presentation
    3804 (KIR2DL3)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3804 (KIR2DL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3804 (KIR2DL3)
CD molecules [BR:hsa04090]
 Proteins
  3804 (KIR2DL3)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 Shisa
Other DBs
NCBI-GeneID: 3804
NCBI-ProteinID: NP_056952
OMIM: 604938
HGNC: 6331
Ensembl: ENSG00000243772
Pharos: P43628(Tbio)
UniProt: P43628 E3NZD8
Structure
LinkDB
Position
19:54738513..54753052
AA seq 341 aa
MSLMVVSMVCVGFFLLQGAWPHEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLL
HREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDI
VITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGT
FQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGN
PRHLHVLIGTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDPQE
VTYAQLNHCVFTQRKITRPSQRPKTPPTDIIVYTELPNAEP
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgtcgctcatggtcgtcagcatggtgtgtgttgggttcttcttgctgcagggggcctgg
ccacatgagggagtccacagaaaaccttccctcctggcccacccaggtcccctggtgaaa
tcagaagagacagtcatcctgcaatgttggtcagatgtcaggtttcagcacttccttctg
cacagagaagggaagtttaaggacactttgcacctcattggagagcaccatgatggggtc
tccaaggccaacttctccatcggtcccatgatgcaagaccttgcagggacctacagatgc
tacggttctgttactcactccccctatcagttgtcagctcccagtgaccctctggacatc
gtcatcacaggtctatatgagaaaccttctctctcagcccagccgggccccacggttctg
gcaggagagagcgtgaccttgtcctgcagctcccggagctcctatgacatgtaccatcta
tccagggagggggaggcccatgaacgtaggttctctgcagggcccaaggtcaacggaaca
ttccaggccgactttcctctgggccctgccacccacggaggaacctacagatgcttcggc
tctttccgtgactctccatacgagtggtcaaactcgagtgacccactgcttgtttctgtc
acaggaaacccttcaaatagttggccttcacccactgaaccaagctccgaaaccggtaac
cccagacacctgcatgttctgattgggacctcagtggtcatcatcctcttcatcctcctc
ctcttctttctccttcatcgctggtgctgcaacaaaaaaaatgctgttgtaatggaccaa
gagcctgcagggaacagaacagtgaacagggaggactctgatgaacaagaccctcaggag
gtgacatatgcacagttgaatcactgcgttttcacacagagaaaaatcactcgcccttct
cagaggcccaagacacccccaacagatatcatcgtgtacacggaacttccaaatgctgag
ccctga

KEGG   Homo sapiens (human): 3811
Entry
3811              CDS       T01001                                 
Symbol
KIR3DL1, CD158E1, KIR, KIR2DL5B, KIR3DL1/S1, NKAT-3, NKAT3, NKB1, NKB1B
Name
(RefSeq) killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 1
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Disease
H01563  HIV infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3811 (KIR3DL1)
   04612 Antigen processing and presentation
    3811 (KIR3DL1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3811 (KIR3DL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3811 (KIR3DL1)
CD molecules [BR:hsa04090]
 Proteins
  3811 (KIR3DL1)
SSDB
Motif
Pfam: ig Ig_2 Ig_3 SIT MAP17
Other DBs
NCBI-GeneID: 3811
NCBI-ProteinID: NP_001309097
OMIM: 604946
HGNC: 6338
Ensembl: ENSG00000167633
Pharos: P43629(Tbio)
UniProt: P43629 Q6H2G3 Q8N6C9
Structure
LinkDB
Position
19:54816438..54830778
AA seq 444 aa
MLLMVVSMACVGFFLVQRAGPHVGGQDKPFLSAWPSAVVPRGGHVTLRCHYRHRFNNFML
YKEDRIHVPIFHGRLFQESFNMSPVTTAHAGNYTCRGSHPHSPTGWSAPSNPVVIMVTGN
HRKPSLLAHPGPLVKSGERVILQCWSDIMFEHFFLHKEGISKDPSRLVGQIHDGVSKANF
SIGPMMLALAGTYRCYGSVTHTPYQLSAPSDPLDIVVTGPYEKPSLSAQPGPKVQAGESV
TLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADFPLGPATHGGTYRCFGSFRHS
PYEWSDPSDPLLVSVTGNPSSSWPSPTEPSSKSGNPRHLHILIGTSVVIILFILLLFFLL
HLWCSNKKNAAVMDQEPAGNRTANSEDSDEQDPEEVTYAQLDHCVFTQRKITRPSQRPKT
PPTDTILYTELPNAKPRSKVVSCP
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgttgctcatggtcgtcagcatggcgtgtgttgggttcttcttggtccagagggccggt
ccacacgtgggtggtcaggacaagcccttcctgtctgcctggcccagcgctgtggtgcct
cgaggaggacacgtgactcttcggtgtcactatcgtcataggtttaacaatttcatgcta
tacaaagaagacagaatccacgttcccatcttccatggcagattattccaggagagcttc
aacatgagccctgtgaccacagcacatgcagggaactacacatgtcggggttcacaccca
cactcccccactgggtggtcggcacccagcaaccccgtggtgatcatggtcacaggaaac
cacagaaaaccttccctcctggcccacccaggtcccctggtgaaatcaggagagagagtc
atcctgcaatgttggtcagatatcatgtttgagcacttctttctgcacaaagaggggatc
tctaaggacccctcacgcctcgttggacagatccatgatggggtctccaaggccaatttc
tccatcggtcccatgatgcttgcccttgcagggacctacagatgctacggttctgttact
cacaccccctatcagttgtcagctcccagtgatcccctggacatcgtggtcacaggtcca
tatgagaaaccttctctctcagcccagccgggccccaaggttcaggcaggagagagcgtg
accttgtcctgcagctcccggagctcctatgacatgtaccatctatccagggagggggga
gcccatgaacgtaggctccctgcagtgcgcaaggtcaacagaacattccaggcagatttc
cctctgggccctgccacccacggagggacctacagatgcttcggctctttccgtcactct
ccctacgagtggtcagacccgagtgacccactgcttgtttctgtcacaggaaacccttca
agtagttggccttcacccacagaaccaagctccaaatctggtaaccccagacacctgcac
attctgattgggacctcagtggtcatcatcctcttcatcctcctcctcttctttctcctt
catctctggtgctccaacaaaaaaaatgctgctgtaatggaccaagagcctgcagggaac
agaacagccaacagcgaggactctgatgaacaagaccctgaggaggtgacatacgcacag
ttggatcactgcgttttcacacagagaaaaatcactcgcccttctcagaggcccaagaca
ccccctacagataccatcttgtacacggaacttccaaatgctaagcccagatccaaagtt
gtctcctgcccatga

KEGG   Homo sapiens (human): 3812
Entry
3812              CDS       T01001                                 
Symbol
KIR3DL2, 3DL2, CD158K, KIR-3DL2, NKAT-4, NKAT4, NKAT4B, p140
Name
(RefSeq) killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2
  KO
K07980  killer cell immunoglobulin-like receptor 3DL
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3812 (KIR3DL2)
   04612 Antigen processing and presentation
    3812 (KIR3DL2)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3812 (KIR3DL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3812 (KIR3DL2)
CD molecules [BR:hsa04090]
 Proteins
  3812 (KIR3DL2)
SSDB
Motif
Pfam: ig Ig_2 Ig_3 MAP17
Other DBs
NCBI-GeneID: 3812
NCBI-ProteinID: NP_006728
OMIM: 604947
HGNC: 6339
Ensembl: ENSG00000240403
Pharos: P43630(Tbio)
UniProt: P43630 Q8NHK6 A0A0U1WNF3
LinkDB
Position
19:54850443..54867207
AA seq 455 aa
MSLTVVSMACVGFFLLQGAWPLMGGQDKPFLSARPSTVVPRGGHVALQCHYRRGFNNFML
YKEDRSHVPIFHGRIFQESFIMGPVTPAHAGTYRCRGSRPHSLTGWSAPSNPLVIMVTGN
HRKPSLLAHPGPLLKSGETVILQCWSDVMFEHFFLHREGISEDPSRLVGQIHDGVSKANF
SIGPLMPVLAGTYRCYGSVPHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVQAGENV
TLSCSSWSSYDIYHLSREGEAHERRLRAVPKVNRTFQADFPLGPATHGGTYRCFGSFRAL
PCVWSNSSDPLLVSVTGNPSSSWPSPTEPSSKSGICRHLHVLIGTSVVIFLFILLLFFLL
YRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQLDHCVFIQRKISRPSQRPKT
PLTDTSVYTELPNAEPRSKVVSCPRAPQSGLEGVF
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgtcgctcacggtcgtcagcatggcgtgcgttgggttcttcttgctgcagggggcctgg
ccactcatgggtggtcaggacaaacccttcctgtctgcccggcccagcactgtggtgcct
cgaggaggacacgtggctcttcagtgtcactatcgtcgtgggtttaacaatttcatgctg
tacaaagaagacagaagccacgttcccatcttccacggcagaatattccaggagagcttc
atcatgggccctgtgaccccagcacatgcagggacctacagatgtcggggttcacgccca
cactccctcactgggtggtcggcacccagcaaccccctggtgatcatggtcacaggaaac
cacagaaaaccttccctcctggcccacccagggcccctgctgaaatcaggagagacagtc
atcctgcaatgttggtcagatgtcatgtttgagcacttctttctgcacagagaggggatc
tctgaggacccctcacgcctcgttggacagatccatgatggggtctccaaggccaacttc
tccatcggtcccttgatgcctgtccttgcaggaacctacagatgttatggttctgttcct
cactccccctatcagttgtcagctcccagtgaccccctggacatcgtgatcacaggtcta
tatgagaaaccttctctctcagcccagccgggccccacggttcaggcaggagagaacgtg
accttgtcctgtagctcctggagctcctatgacatctaccatctgtccagggaaggggag
gcccatgaacgtaggctccgtgcagtgcccaaggtcaacagaacattccaggcagacttt
cctctgggccctgccacccacggagggacctacagatgcttcggctctttccgtgccctg
ccctgcgtgtggtcaaactcaagtgacccactgcttgtttctgtcacaggaaacccttca
agtagttggccttcacccacagaaccaagctccaaatctggtatctgcagacacctgcat
gttctgattgggacctcagtggtcatcttcctcttcatcctcctcctcttctttctcctt
tatcgctggtgctccaacaaaaagaatgctgctgtaatggaccaagagcctgcgggggac
agaacagtgaataggcaggactctgatgaacaagaccctcaggaggtgacgtacgcacag
ttggatcactgcgttttcatacagagaaaaatcagtcgcccttctcagaggcccaagaca
cccctaacagataccagcgtgtacacggaacttccaaatgctgagcccagatccaaagtt
gtctcctgcccacgagcaccacagtcaggtcttgagggggttttctag

KEGG   Homo sapiens (human): 3821
Entry
3821              CDS       T01001                                 
Symbol
KLRC1, CD159A, NKG2, NKG2A
Name
(RefSeq) killer cell lectin like receptor C1
  KO
K06541  killer cell lectin-like receptor subfamily C1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3821 (KLRC1)
   04612 Antigen processing and presentation
    3821 (KLRC1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3821 (KLRC1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3821 (KLRC1)
   04091 Lectins [BR:hsa04091]
    3821 (KLRC1)
CD molecules [BR:hsa04090]
 Proteins
  3821 (KLRC1)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   3821 (KLRC1)
SSDB
Motif
Pfam: Lectin_C UL45 Chordopox_A33R
Other DBs
NCBI-GeneID: 3821
NCBI-ProteinID: NP_002250
OMIM: 161555
HGNC: 6374
Ensembl: ENSG00000134545
Pharos: P26715(Tbio)
UniProt: P26715
Structure
LinkDB
Position
12:complement(10442264..10454685)
AA seq 233 aa
MDNQGVIYSDLNLPPNPKRQQRKPKGNKNSILATEQEITYAELNLQKASQDFQGNDKTYH
CKDLPSAPEKLIVGILGIICLILMASVVTIVVIPSTLIQRHNNSSLNTRTQKARHCGHCP
EEWITYSNSCYYIGKERRTWEESLLACTSKNSSLLSIDNEEEMKFLSIISPSSWIGVFRN
SSHHPWVTMNGLAFKHEIKDSDNAELNCAVLQVNRLKSAQCGSSIIYHCKHKL
NT seq 702 nt   +upstreamnt  +downstreamnt
atggataaccaaggagtaatctactcagacctgaatctgcccccaaacccaaagaggcag
caacgaaaacctaaaggcaataaaaactccattttagcaactgaacaggaaataacctat
gcggaattaaaccttcaaaaagcttctcaggattttcaagggaatgacaaaacctatcac
tgcaaagatttaccatcagctccagagaagctcattgttgggatcctgggaattatctgt
cttatcttaatggcctctgtggtaacgatagttgttattccctctacattaatacagagg
cacaacaattcttccctgaatacaagaactcagaaagcacgtcattgtggccattgtcct
gaggagtggattacatattccaacagttgttactacattggtaaggaaagaagaacttgg
gaagagagtttgctggcctgtacttcgaagaactccagtctgctttctatagataatgaa
gaagaaatgaaatttctgtccatcatttcaccatcctcatggattggtgtgtttcgtaac
agcagtcatcatccatgggtgacaatgaatggtttggctttcaaacatgagataaaagac
tcagataatgctgaacttaactgtgcagtgctacaagtaaatcgacttaaatcagcccag
tgtggatcttcaataatatatcattgtaagcataagctttag

KEGG   Homo sapiens (human): 3824
Entry
3824              CDS       T01001                                 
Symbol
KLRD1, CD94
Name
(RefSeq) killer cell lectin like receptor D1
  KO
K06516  killer cell lectin-like receptor subfamily D member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3824 (KLRD1)
   04612 Antigen processing and presentation
    3824 (KLRD1)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    3824 (KLRD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3824 (KLRD1)
   04091 Lectins [BR:hsa04091]
    3824 (KLRD1)
CD molecules [BR:hsa04090]
 Proteins
  3824 (KLRD1)
Lectins [BR:hsa04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   3824 (KLRD1)
SSDB
Motif
Pfam: Lectin_C Chordopox_A33R Ly49
Other DBs
NCBI-GeneID: 3824
NCBI-ProteinID: NP_001107868
OMIM: 602894
HGNC: 6378
Ensembl: ENSG00000134539
Pharos: Q13241(Tbio)
UniProt: Q13241 Q53ZY6
Structure
LinkDB
Position
12:10238961..10329608
AA seq 179 aa
MAVFKTTLWRLISGTLGIICLSLMSTLGILLKNSFTKLSIEPAFTPGPNIELQKDSDCCS
CQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLS
YSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI
NT seq 540 nt   +upstreamnt  +downstreamnt
atggcagtgtttaagaccactctgtggaggttaatttctgggaccttagggataatatgc
ctttcgttgatgtctacgttgggaattttgttgaaaaattcttttactaaactgagtatt
gagccagcatttactccaggacccaacatagaactccagaaagactctgactgctgttct
tgccaagaaaaatgggttgggtaccggtgcaactgttacttcatttccagtgaacagaaa
acttggaacgaaagtcggcatctctgtgcttctcagaaatccagcctgcttcagcttcaa
aacacagatgaactggattttatgagctccagtcaacaattttactggattggactctct
tacagtgaggagcacaccgcctggttgtgggagaatggctctgcactctcccagtatcta
tttccatcatttgaaacttttaatacaaagaactgcatagcgtataatccaaatggaaat
gctttagatgaatcctgtgaagataaaaatcgttatatctgtaagcaacagctcatttaa

KEGG   Homo sapiens (human): 57292
Entry
57292             CDS       T01001                                 
Symbol
KIR2DL5A, CD158F, KIR2DL5, KIR2DL5.1, KIR2DL5.3
Name
(RefSeq) killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 5A
  KO
K24232  killer cell immunoglobulin-like receptor 2DL5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    57292 (KIR2DL5A)
   04612 Antigen processing and presentation
    57292 (KIR2DL5A)
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    57292 (KIR2DL5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    57292 (KIR2DL5A)
CD molecules [BR:hsa04090]
 Proteins
  57292 (KIR2DL5A)
SSDB
Motif
Pfam: ig Ig_2 Ig_3 V-set Shisa SIT WBP-1
Other DBs
NCBI-GeneID: 57292
NCBI-ProteinID: NP_065396
OMIM: 605305
HGNC: 16345
Pharos: Q8N109(Tdark)
UniProt: Q8N109 A0A191URI1
LinkDB
Position
19p13.3
AA seq 375 aa
MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSL
YKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGL
FGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADF
PLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH
ILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQ
LDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTAL
SQNRVASSHVPAAGI
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgtcgctcatggtcatcagcatggcgtgtgttgggttcttcttgctgcagggggcctgg
acacatgagggtggtcaggacaagcccttgctgtctgcctggcccagcgctgtggtgcct
cgaggaggacatgtgactcttctgtgtcgctctcgtcttgggtttaccatcttcagtctg
tacaaagaagatggggtgcctgtccctgagctctacaacaaaatattctggaagagcatc
ctcatgggccctgtgacccctgcacacgcagggacctacagatgtcggggttcacaccca
cgctcccccattgagtggtcagcacccagcaaccccctggtgatcgtggtcacaggtcta
tttgggaaaccttcactctcagcccagccgggccccacggttcgcacaggagagaacgtg
accttgtcctgcagctccaggagctcatttgacatgtaccatctatccagggaggggagg
gcccatgaacctaggctccctgcagtgcccagcgtcaatggaacattccaggctgacttt
cctctgggccctgccacccacggagggacctacacatgcttcggctctctccatgactca
ccctatgagtggtcagacccgagtgacccactgcttgtttctgtcacaggaaactcttca
agtagttcatcttcacccactgaaccaagctccaaaactggtatccgcagacacctgcac
attctgattgggacctcagtggctatcatcctcttcatcatcctcttcttctttctcctt
cattgctgctgctccaacaaaaagaatgctgctgtaatggaccaagagcctgccggggac
agaacagtgaacagggaggactctgatgatcaagaccctcaggaggtgacatatgcacag
ttggatcactgcgttttcacacagacaaaaatcacttccccttctcagaggcccaagaca
cctccaacagataccaccatgtacatggaacttccaaatgctaagccaagatcattgtct
cctgcccataagcaccacagtcaggccttgaggggatcttctagggagacaacagccctg
tctcaaaaccgggttgctagctcccatgtaccagcagctggaatctga

DBGET integrated database retrieval system