KEGG   Homo sapiens (human): 1161
Entry
1161              CDS       T01001                                 
Symbol
ERCC8, CKN1, CSA, UVSS2
Name
(RefSeq) ERCC excision repair 8, CSA ubiquitin ligase complex subunit
  KO
K10570  DNA excision repair protein ERCC-8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04120  Ubiquitin mediated proteolysis
Network
nt06502  Nucleotide excision repair
  Element
N01430  Transcription-coupled NER
Disease
H00076  Cockayne syndrome
H00403  Disorders of nucleotide excision repair
H02131  UV-sensitive syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    1161 (ERCC8)
  09124 Replication and repair
   03420 Nucleotide excision repair
    1161 (ERCC8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    1161 (ERCC8)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    1161 (ERCC8)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     1161 (ERCC8)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      1161 (ERCC8)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 NBCH_WD40 Nup160
Other DBs
NCBI-GeneID: 1161
NCBI-ProteinID: NP_000073
OMIM: 609412
HGNC: 3439
Ensembl: ENSG00000049167
Pharos: Q13216(Tbio)
UniProt: Q13216
Structure
LinkDB
Position
5:complement(60866454..60945070)
AA seq 396 aa
MLGFLSARQTGLEDPLRLRRAESTRRVLGLELNKDRDVERIHGGGINTLDIEPVEGRYML
SGGSDGVIVLYDLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETVQWYPHDTGMFTSSSF
DKTLKVWDTNTLQTADVFNFEETVYSHHMSPVSTKHCLVAVGTRGPKVQLCDLKSGSCSH
ILQGHRQEILAVSWSPRYDYILATASADSRVKLWDVRRASGCLITLDQHNGKKSQAVESA
NTAHNGKVNGLCFTSDGLHLLTVGTDNRMRLWNSSNGENTLVNYGKVCNNSKKGLKFTVS
CGCSSEFVFVPYGSTIAVYTVYSGEQITMLKGHYKTVDCCVFQSNFQELYSGSRDCNILA
WVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgctggggtttttgtccgcacgccaaacgggtttggaggaccctcttcgccttcggaga
gcagagtcaacacggagagttttgggactggaattaaataaagacagagatgttgaaaga
atccacggcggtggaattaacacccttgacattgaacctgttgaagggagatacatgtta
tcaggtggttcagatggtgtgattgtactttatgaccttgagaactccagcagacaatct
tattacacatgtaaagcagtgtgttccattggcagagatcatcctgatgttcacagatac
agtgtggagactgtacagtggtatcctcatgacactggcatgttcacatcaagctcattt
gataaaactctgaaagtatgggatacaaatacattacaaactgcagatgtatttaatttt
gaggaaacagtttatagtcatcatatgtctccagtctccaccaagcactgtttggtagca
gttggtactagaggacccaaagtacaactttgtgacttgaagtctggatcctgttctcac
attctacagggtcacagacaagaaatattagcagtttcctggtctccacgttatgactat
atcttggcaacagcaagtgctgacagtagagtaaaattatgggatgtgagaagagcatca
ggatgtttgattactcttgatcaacataatgggaaaaagtcacaagctgttgaatcagca
aacactgctcataatgggaaagttaatggcttatgttttacaagtgatggacttcacctc
ctcactgttggtacagataatcgaatgaggctctggaatagttccaatggagaaaacaca
cttgtgaactatggaaaagtttgtaataacagtaaaaaaggattgaaattcactgtctcc
tgtggctgcagttcagaatttgtttttgtaccatatggtagcaccattgctgtttataca
gtttactcaggagaacagataactatgcttaagggacattataaaactgttgactgctgt
gtatttcagtcaaatttccaggaactttatagtggtagcagagactgcaacattctggct
tgggttccatccttatatgaaccagttcctgatgatgatgagactacaacaaaatcacaa
ttaaatccggcctttgaagatgcctggagcagcagtgatgaagaaggatga

KEGG   Homo sapiens (human): 1643
Entry
1643              CDS       T01001                                 
Symbol
DDB2, DDBB, UV-DDB2, XPE
Name
(RefSeq) damage specific DNA binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03420  Nucleotide excision repair
hsa04115  p53 signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05161  Hepatitis B
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05216  Thyroid cancer
hsa05217  Basal cell carcinoma
hsa05218  Melanoma
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06140  Transcription (viruses)
nt06165  Epstein-Barr virus (EBV)
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06267  Small cell lung cancer
nt06268  Melanoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
nt06502  Nucleotide excision repair
  Element
N00115  Mutation-inactivated TP53 to transcription
N00223  EBV EBNA1 to p53-mediated transcription
N00263  EBV EBNA3C to p53-mediated transcription
N00481  EBV BZLF1 to p53-mediated transcription
N01425  Global genome NER
Disease
H00403  Disorders of nucleotide excision repair
H01428  Xeroderma pigmentosum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    1643 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    1643 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    1643 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1643 (DDB2)
   05202 Transcriptional misregulation in cancer
    1643 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    1643 (DDB2)
   05212 Pancreatic cancer
    1643 (DDB2)
   05225 Hepatocellular carcinoma
    1643 (DDB2)
   05226 Gastric cancer
    1643 (DDB2)
   05214 Glioma
    1643 (DDB2)
   05216 Thyroid cancer
    1643 (DDB2)
   05220 Chronic myeloid leukemia
    1643 (DDB2)
   05217 Basal cell carcinoma
    1643 (DDB2)
   05218 Melanoma
    1643 (DDB2)
   05213 Endometrial cancer
    1643 (DDB2)
   05224 Breast cancer
    1643 (DDB2)
   05222 Small cell lung cancer
    1643 (DDB2)
   05223 Non-small cell lung cancer
    1643 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    1643 (DDB2)
   05169 Epstein-Barr virus infection
    1643 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    1643 (DDB2)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    1643 (DDB2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     1643 (DDB2)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      1643 (DDB2)
SSDB
Motif
Pfam: WD40 NBCH_WD40
Other DBs
NCBI-GeneID: 1643
NCBI-ProteinID: NP_000098
OMIM: 600811
HGNC: 2718
Ensembl: ENSG00000134574
Pharos: Q92466(Tbio)
UniProt: Q92466
Structure
LinkDB
Position
11:47214454..47239217
AA seq 427 aa
MAPKKRPETQKTSEIVLRPRNKRSRSPLELEPEAKKLCAKGSGPSRRCDSDCLWVGLAGP
QILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH
PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT
TRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG
ARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHILIWSQ
EEARTRK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctcccaagaaacgcccagaaacccagaagacctccgagattgtattacgccccagg
aacaagaggagcaggagtcccctggagctggagcccgaggccaagaagctctgtgcgaag
ggctccggtcctagcagaagatgtgactcagactgcctctgggtggggctggctggccca
cagatcctgccaccatgccgcagcatcgtcaggaccctccaccagcataagctgggcaga
gcttcctggccatctgtccagcaggggctccagcagtcctttttgcacactctggattct
taccggatattacaaaaggctgccccctttgacaggagggctacatccttggcgtggcac
ccaactcaccccagcaccgtggctgtgggttccaaagggggagatatcatgctctggaat
tttggcatcaaggacaaacccaccttcatcaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccaaccagttttacgcctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacattctacgagtttttgccagctcagacaccatc
aacatctggttttgtagcctggatgtgtctgctagtagccgaatggtggtcacaggagac
aacgtggggaacgtgatcctgctgaacatggacggcaaagagctttggaatctcagaatg
cacaaaaagaaagtgacgcatgtggccctgaacccatgctgtgattggttcctggccaca
gcctccgtagatcaaacagtgaaaatttgggacctgcgccaggttagagggaaagccagc
ttcctctactcgctgccgcacaggcatcctgtcaacgcagcttgtttcagtcccgatgga
gcccggctcctgaccacggaccagaagagcgagatccgagtttactctgcttcccagtgg
gactgccccctgggcctgatcccgcaccctcaccgtcacttccagcacctcacacccatc
aaggcagcctggcatcctcgctacaacctcattgttgtgggccgatacccagatcctaat
ttcaaaagttgtaccccttatgaattgaggacgatcgacgtgttcgatggaaactcaggg
aagatgatgtgtcagctctatgacccagaatcttctggcatcagttcgcttaatgaattc
aatcccatgggggacacgctggcctctgcaatgggttaccacattctcatctggagccag
gaggaagccaggacacggaagtga

KEGG   Homo sapiens (human): 55070
Entry
55070             CDS       T01001                                 
Symbol
DET1
Name
(RefSeq) DET1 partner of COP1 E3 ubiquitin ligase
  KO
K10571  de-etiolated-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    55070 (DET1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    55070 (DET1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     55070 (DET1)
SSDB
Motif
Pfam: Det1
Other DBs
NCBI-GeneID: 55070
NCBI-ProteinID: NP_001137546
OMIM: 608727
HGNC: 25477
Ensembl: ENSG00000140543
Pharos: Q7L5Y6(Tdark)
UniProt: Q7L5Y6 A0A024RC56
LinkDB
Position
15:complement(88501919..88546703)
AA seq 550 aa
MDHHVSTIKPRRIQNQNVIHRLERRRISSGKAGTHWHQVRVFHQNVFPNFTVVNVEKPPC
FLRKFSPDGRYFIAFSSDQTSLEIYEYQGCQAAEDLLQGYEGEILSNGNDQRSVNIRGRL
FERFFVLLHITNVAANGEHLNRECSLFTDDCRCVIVGSAAYLPDEPHPPFFEVYRNSESV
TPNPRSPLEDYSLHIIDLHTGRLCDTRTFKCDKVVLSHNQGLYLYKNILAILSVQQQTIH
VFQVTPEGTFIDVRTIGRFCYEDDLLTVSAVFPEVQRDSQTGMANPFRDPFINSLKHRLL
VYLWRRAEQDGSAMAKRRFFQYFDQLRQLRMWKMQLLDENHLFIKYTSEDVVTLRVTDPS
QASFFVVYNMVTTEVIAVFENTSDELLELFENFCDLFRNATLHSEVQFPCSASSNNFARQ
IQRRFKDTIINAKYGGHTEAVRRLLGQLPISAQSYSGSPYLDLSLFSYDDKWVSVMERPK
TCGDHPIRFYARDSGLLKFEIQAGLLGRPINHTVRRLVAFTFHPFEPFAISVQRTNAEYV
VNFHMRHCCT
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggatcatcatgtttctaccatcaagcctcgaagaatccaaaaccaaaatgtcattcac
cgcttggaacgccggcggatcagttcaggcaaggcaggtacccactggcaccaagtccga
gtgttccatcagaatgtcttccccaacttcacagttgtcaacgttgaaaagcctccttgt
ttcttgcgtaaattctcacctgatggacgctactttattgctttttcttcagaccagaca
tctcttgaaatctatgagtaccagggctgccaggcagcagaggacctactgcagggatac
gaaggagaaatcctgtccaatggcaatgaccagcggtcagtgaatatccggggccggctc
tttgaacgcttttttgtcctgctgcacattaccaatgttgcggccaatggtgagcacctg
aaccgggagtgtagtctcttcactgatgactgccgctgtgtcatcgtgggctcagctgcc
tacctcccagatgagcctcaccctccattttttgaggtatatcggaacagtgaatcagtg
acccccaacccacggtcccctctagaagactattccctccatatcattgaccttcacacc
ggccgcttatgtgatacacgcacgttcaagtgtgacaaggtggtcttgtcacacaaccaa
gggctgtacttgtacaaaaacatcctggccatcttgtctgtgcaacaacagaccatccat
gtcttccaggtgactcctgaaggcactttcattgatgtgcggaccattggccgcttttgc
tatgaggatgacctgctcactgtgtcagctgttttccctgaggtacagcgggacagtcag
acaggcatggccaatccctttagggatcctttcatcaattccctcaaacaccggttgctg
gtatatttgtggcgccgggcagaacaggatggtagtgcaatggccaagaggcgcttcttc
cagtattttgaccaactgcggcagctgcgaatgtggaaaatgcagcttctggatgaaaac
cacctgtttatcaagtacactagtgaggatgtagtaacactgcgagtcacagatccatca
caggcatctttctttgtggtgtacaatatggtgacgacagaggtgattgctgtgtttgag
aatacatcagatgagcttttggagctctttgagaacttctgtgacctttttcgtaatgct
accctgcacagtgaagttcagtttccctgctcagcttctagcaacaattttgcaaggcag
atccagcgccggttcaaagacactattataaatgccaagtatggagggcacacagaggca
gtacgccggctgctgggtcagctccccatcagtgctcagtcttacagcggtagcccctat
ctggatttgtctctcttcagttatgatgacaagtgggtatctgtcatggagcggcccaag
acttgtggagatcacccaatcaggttctatgcccgggactcgggcctgctcaagtttgag
atccaggcggggttattgggccgccccatcaaccacacagtgcgacgccttgttgccttc
acctttcacccttttgagcctttcgctatttctgtgcagaggactaatgctgagtatgtt
gtcaacttccatatgcgacactgctgcacgtag

KEGG   Homo sapiens (human): 64326
Entry
64326             CDS       T01001                                 
Symbol
COP1, CFAP78, FAP78, RFWD2, RNF200
Name
(RefSeq) COP1 E3 ubiquitin ligase
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    64326 (COP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    64326 (COP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    64326 (COP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     64326 (COP1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    64326 (COP1)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     64326 (COP1)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_UBOX zf-RING_5 zf-C3HC4_4 WD40_like zf-rbx1 zf_C2H2_10 zf-RING_10 Prok-RING_4 zf-RING_4 zf-RING_11 DZR zf-Nse
Other DBs
NCBI-GeneID: 64326
NCBI-ProteinID: NP_071902
OMIM: 608067
HGNC: 17440
Ensembl: ENSG00000143207
Pharos: Q8NHY2(Tbio)
UniProt: Q8NHY2
Structure
LinkDB
Position
1:complement(175944831..176207286)
AA seq 731 aa
MSGSRQAGSGSAGTSPGSSAASSVTSASSSLSSSPSPPSVAVSAAALVSGGVAQAAGSGG
LGGPVRPVLVAPAVSGSGGGAVSTGLSRHSCAARPSAGVGGSSSSLGSGSRKRPLLAPLC
NGLINSYEDKSNDFVCPICFDMIEEAYMTKCGHSFCYKCIHQSLEDNNRCPKCNYVVDNI
DHLYPNFLVNELILKQKQRFEEKRFKLDHSVSSTNGHRWQIFQDWLGTDQDNLDLANVNL
MLELLVQKKKQLEAESHAAQLQILMEFLKVARRNKREQLEQIQKELSVLEEDIKRVEEMS
GLYSPVSEDSTVPQFEAPSPSHSSIIDSTEYSQPPGFSGSSQTKKQPWYNSTLASRRKRL
TAHFEDLEQCYFSTRMSRISDDSRTASQLDEFQECLSKFTRYNSVRPLATLSYASDLYNG
SSIVSSIEFDRDCDYFAIAGVTKKIKVYEYDTVIQDAVDIHYPENEMTCNSKISCISWSS
YHKNLLASSDYEGTVILWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKL
WSTNLDNSVASIEAKANVCCVKFSPSSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRK
AVSYAKFVSGEEIVSASTDSQLKLWNVGKPYCLRSFKGHINEKNFVGLASNGDYIACGSE
NNSLYLYYKGLSKTLLTFKFDTVKSVLDKDRKEDDTNEFVSAVCWRALPDGESNVLIAAN
SQGTIKVLELV
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgtctggtagccgccaggccgggtcgggctccgctgggacaagccccgggtcctcggcg
gcctcctcggtgacttccgcctcctcgtctttatcctcttccccgtcgccgccttccgtg
gcggtttcggcggcagcgctggtgtccggcggggtggcccaggccgccggctcgggcggc
ctcgggggcccggtgcggcctgtgttggtggcgcccgccgtatcgggtagcggcggcggg
gcggtgtccacgggcctgtcccggcacagctgcgcggccaggcccagcgccggcgtagga
ggcagcagctccagcctaggcagcggcagcaggaagcgacctctcctcgcccccctctgc
aacgggctcatcaactcctacgaggacaaaagcaacgacttcgtatgccccatctgcttt
gatatgattgaagaagcatacatgacaaaatgtggccacagcttttgctacaagtgtatt
catcagagtttggaggacaataatagatgtcccaagtgtaactatgttgtggacaatatt
gaccatctgtatcctaatttcttggtgaatgaactcattcttaaacagaagcaaagattt
gaggaaaagaggttcaaattggaccactcagtgagtagcaccaatggccacaggtggcag
atatttcaagattggttgggaactgaccaagataaccttgatttggccaatgtcaatctt
atgttggagttactagtgcagaagaagaaacaactggaagcagaatcacatgcagcccaa
ctacagattcttatggaattcctcaaggttgcaagaagaaataagagagagcaactggaa
cagatccagaaggagctaagtgttttggaagaggatattaagagagtggaagaaatgagt
ggcttatactctcctgtcagtgaggatagcacagtgcctcaatttgaagctccttctcca
tcacacagtagtattattgattccacagaatacagccaacctccaggtttcagtggcagt
tctcagacaaagaaacagccttggtataatagcacgttagcatcaagacgaaaacgactt
actgctcattttgaagacttggagcagtgttacttttctacaaggatgtctcgtatctca
gatgacagtcgaactgcaagccagttggatgaatttcaggaatgcttgtccaagtttact
cgatataattcagtacgacctttagccacattgtcatatgctagtgatctctataatggt
tccagtatagtctctagtattgaatttgaccgggattgtgactattttgcgattgctgga
gttacaaagaagattaaagtctatgaatatgacactgtcatccaggatgcagtggatatt
cattaccctgagaatgaaatgacctgcaattcgaaaatcagctgtatcagttggagtagt
taccataagaacctgttagctagcagtgattatgaaggcactgttattttatgggatgga
ttcacaggacagaggtcaaaggtctatcaggagcatgagaagaggtgttggagtgttgac
tttaatttgatggatcctaaactcttggcttcaggttctgatgatgcaaaagtgaagctg
tggtctaccaatctagacaactcagtggcaagcattgaggcaaaggctaatgtgtgctgt
gttaaattcagcccctcttccagataccatttggctttcggctgtgcagatcactgtgtc
cactactatgatcttcgtaacactaaacagccaatcatggtattcaaaggacaccgtaaa
gcagtctcttatgcaaagtttgtgagtggtgaggaaattgtctctgcctcaacagacagt
cagctaaaactgtggaatgtagggaaaccatactgcctacgttccttcaagggtcatatc
aatgaaaaaaactttgtaggcctggcttccaatggagattatatagcttgtggaagtgaa
aataactctctctacctgtactataaaggactttctaagactttgctaacttttaagttt
gatacagtcaaaagtgttctcgacaaagaccgaaaagaagatgatacaaatgaatttgtt
agtgctgtgtgctggagggcactaccagatggggagtccaatgtgctgattgctgctaac
agtcagggtacaattaaggtgctagaattggtatga

DBGET integrated database retrieval system