KEGG   Homo sapiens (human): 116443
Entry
116443            CDS       T01001                                 
Symbol
GRIN3A, GluN3A, NMDAR-L, NMDAR3A, NR3A
Name
(RefSeq) glutamate ionotropic receptor NMDA type subunit 3A
  KO
K05213  glutamate receptor ionotropic, NMDA 3A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04724  Glutamatergic synapse
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05033  Nicotine addiction
hsa05034  Alcoholism
Drug target
Felbamate: D00536<US>
Orphenadrine (DG01252): D08305
Orphenadrine (chloride): D02599
Orphenadrine (citrate): D00774<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    116443 (GRIN3A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    116443 (GRIN3A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    116443 (GRIN3A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    116443 (GRIN3A)
   05020 Prion disease
    116443 (GRIN3A)
  09165 Substance dependence
   05030 Cocaine addiction
    116443 (GRIN3A)
   05031 Amphetamine addiction
    116443 (GRIN3A)
   05033 Nicotine addiction
    116443 (GRIN3A)
   05034 Alcoholism
    116443 (GRIN3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    116443 (GRIN3A)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   116443 (GRIN3A)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor DUF5446
Other DBs
NCBI-GeneID: 116443
NCBI-ProteinID: NP_597702
OMIM: 606650
HGNC: 16767
Ensembl: ENSG00000198785
Pharos: Q8TCU5(Tclin)
UniProt: Q8TCU5
LinkDB
Position
9:complement(101569352..101738647)
AA seq 1115 aa
MRRLSLWWLLSRVCLLLPPPCALVLAGVPSSSSHPQPCQILKRIGHAVRVGAVHLQPWTT
APRAASRAPDDSRAGAQRDEPEPGTRRSPAPSPGARWLGSTLHGRGPPGSRKPGEGARAE
ALWPRDALLFAVDNLNRVEGLLPYNLSLEVVMAIEAGLGDLPLLPFSSPSSPWSSDPFSF
LQSVCHTVVVQGVSALLAFPQSQGEMMELDLVSLVLHIPVISIVRHEFPRESQNPLHLQL
SLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLLLTQNNSKFHLGSIINITAN
LPSTQDLLSFLQIQLESIKNSTPTVVMFGCDMESIRRIFEITTQFGVMPPELRWVLGDSQ
NVEELRTEGLPLGLIAHGKTTQSVFEHYVQDAMELVARAVATATMIQPELALIPSTMNCM
EVETTNLTSGQYLSRFLANTTFRGLSGSIRVKGSTIVSSENNFFIWNLQHDPMGKPMWTR
LGSWQGGKIVMDYGIWPEQAQRHKTHFQHPSKLHLRVVTLIEHPFVFTREVDDEGLCPAG
QLCLDPMTNDSSTLDSLFSSLHSSNDTVPIKFKKCCYGYCIDLLEKIAEDMNFDFDLYIV
GDGKYGAWKNGHWTGLVGDLLRGTAHMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTR
DTAAPIGAFMWPLHWTMWLGIFVALHITAVFLTLYEWKSPFGLTPKGRNRSKVFSFSSAL
NICYALLFGRTVAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI
HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVEYLKNDPEKLD
AFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFM
DMLHDKWYRVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLL
PRIKNKSKLQYWLHTSQRLHRAINTSFIEEKQQHFKTKRVEKRSNVGPRQLTVWNTSNLS
HDNRRKYIFSDEEGQNQLGIRIHQDIPLPPRRRELPALRTTNGKADSLNVSRNSVMQELS
ELEKQIQVIRQELQLAVSRKTELEEYQRTSRTCES
NT seq 3348 nt   +upstreamnt  +downstreamnt
atgaggagactgagtttgtggtggctgctgagcagggtctgtctgctgttgccgccgccc
tgcgcactggtgctggccggggtgcccagctcctcctcgcacccgcagccctgccagatc
ctcaagcgcatcgggcacgcggtgagggtgggcgcggtgcacttgcagccctggaccacc
gccccccgcgcggccagccgcgctccggacgacagccgagcaggagcccagagggatgag
ccggagccagggactaggcggtccccggcgccctcgccgggcgcacgctggttggggagc
accctgcatggccgggggccgccgggctcccgtaagcccggggagggcgccagggcggag
gccctgtggccacgggacgccctcctatttgccgtggacaacctgaaccgcgtggaaggg
ctgctaccctacaacctgtctttggaagtagtgatggccatcgaggcaggcctgggcgat
ctgccacttttgcccttctcctcccctagttcgccatggagcagtgaccctttctccttc
ctgcaaagtgtgtgccataccgtggtggtgcaaggggtgtcggcgctgctcgccttcccc
cagagccagggcgaaatgatggagctcgacttggtcagcttagtcctgcacattccagtg
atcagcatcgtgcgccacgagtttccacgggagagtcagaatccccttcacctacaactg
agtttagaaaattcattaagttctgatgctgatgtcactgtctcaatcctgaccatgaac
aactggtacaattttagcttgttgctgtgccaggaagactggaacatcaccgacttcctc
ctccttacccagaataattccaagttccaccttggttctatcatcaacatcaccgctaac
ctcccctccacccaggacctcttgagcttcctacagatccagcttgagagtattaagaac
agcacacccacagtggtgatgtttggctgcgacatggaaagtatccggcggattttcgaa
attacaacccagtttggggtcatgccccctgaacttcgttgggtgctgggagattcccag
aatgtggaggaactgaggacagagggtctgcccttagggctcattgctcatggaaaaaca
acacagtctgtctttgagcactacgtacaagatgctatggagctggtcgcaagagctgta
gccacagccaccatgatccaaccagaacttgctctcattcccagcacgatgaactgcatg
gaggtggaaactacaaatctcacttcaggacaatatttatcaaggtttctagccaatacc
actttcagaggcctcagtggttccatcagagtaaaaggttccaccatcgtcagctcagaa
aacaactttttcatctggaatcttcaacatgaccccatgggaaagccaatgtggacccgc
ttgggcagctggcaggggggaaagattgtcatggactatggaatatggccagagcaggcc
cagagacacaaaacccacttccaacatccaagtaagctacacttgagagtggttaccctg
attgagcatccttttgtcttcacaagggaggtagatgatgaaggcttgtgccctgctggc
caactctgtctagaccccatgactaatgactcttccacattggacagcctttttagcagc
ctccatagcagtaatgatacagtgcccattaaattcaagaagtgctgctatggatattgc
attgatctgctggaaaagatagcagaagacatgaactttgacttcgacctctatattgta
ggggatggaaagtatggagcatggaaaaatgggcactggactgggctagtgggtgatctc
ctgagagggactgcccacatggcagtcacttcctttagcatcaatactgcacggagccag
gtgatagatttcaccagccctttcttctccaccagcttgggcatcttagtgaggacccga
gatacagcagctcccattggagccttcatgtggccactccactggacaatgtggctgggg
atttttgtggctctgcacatcactgccgtcttcctcactctgtatgaatggaagagtcca
tttggtttgactcccaaggggcgaaatagaagtaaagtcttctccttttcttcagccttg
aacatctgttatgccctcttgtttggcagaacagtggccatcaaacctccaaaatgttgg
actggaaggtttctaatgaacctttgggccattttctgtatgttttgcctttccacatac
acggcaaacttggctgctgtcatggtaggtgagaagatctatgaagagctttctggaata
catgaccccaagttacatcatccttcccaaggattccgctttggaactgtccgagaaagc
agtgctgaagattatgtgagacaaagtttcccagagatgcatgaatatatgagaaggtac
aatgttccagccacccctgatggagtggagtatctgaagaatgatccagagaaactagac
gccttcatcatggacaaagcccttctggattatgaagtgtcaatagatgctgactgcaaa
cttctcactgtggggaagccatttgccatagaaggatacggcattggcctcccacccaac
tctccattgaccgccaacatatccgagctaatcagtcaatacaagtcacatgggtttatg
gatatgctccatgacaagtggtacagggtggttccctgtggcaagagaagttttgctgtc
acggagactttgcaaatgggcatcaaacacttctctgggctctttgtgctgctgtgcatt
ggatttggtctgtccattttgaccaccattggtgagcacatagtatacaggctgctgcta
ccacgaatcaaaaacaaatccaagctgcaatactggctccacaccagccagagattacac
agagcaataaatacatcatttatagaggaaaagcagcagcatttcaagaccaaacgtgtg
gaaaagaggtctaatgtgggaccccgtcagcttaccgtatggaatacttccaatctgagt
catgacaaccgacggaaatacatctttagtgatgaggaaggacaaaaccagctgggcatc
cggatccaccaggacatccccctccctccaaggagaagagagctccctgccttgcggacc
accaatgggaaagcagactccctaaatgtatctcggaactcagtgatgcaggaactctca
gagctcgagaagcagattcaggtgatccgtcaggagctgcagctggctgtgagcaggaaa
acggagctggaggagtatcaaaggacaagtcggacttgtgagtcctag

KEGG   Homo sapiens (human): 116444
Entry
116444            CDS       T01001                                 
Symbol
GRIN3B, GluN3B, NR3B
Name
(RefSeq) glutamate ionotropic receptor NMDA type subunit 3B
  KO
K05214  glutamate receptor ionotropic, NMDA 3B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04724  Glutamatergic synapse
hsa05017  Spinocerebellar ataxia
hsa05020  Prion disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05033  Nicotine addiction
hsa05034  Alcoholism
Drug target
Felbamate: D00536<US>
Orphenadrine (DG01252): D08305
Orphenadrine (chloride): D02599
Orphenadrine (citrate): D00774<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    116444 (GRIN3B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    116444 (GRIN3B)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    116444 (GRIN3B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    116444 (GRIN3B)
   05020 Prion disease
    116444 (GRIN3B)
  09165 Substance dependence
   05030 Cocaine addiction
    116444 (GRIN3B)
   05031 Amphetamine addiction
    116444 (GRIN3B)
   05033 Nicotine addiction
    116444 (GRIN3B)
   05034 Alcoholism
    116444 (GRIN3B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    116444 (GRIN3B)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   116444 (GRIN3B)
SSDB
Motif
Pfam: Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor
Other DBs
NCBI-GeneID: 116444
NCBI-ProteinID: NP_619635
OMIM: 606651
HGNC: 16768
Ensembl: ENSG00000116032
Pharos: O60391(Tclin)
UniProt: O60391 Q5F0I5
LinkDB
Position
19:1000419..1009732
AA seq 1043 aa
MEFVRALWLGLALALGPGSAGGHPQPCGVLARLGGSVRLGALLPRAPLARARARAALARA
ALAPRLPHNLSLELVVAAPPARDPASLTRGLCQALVPPGVAALLAFPEARPELLQLHFLA
AATETPVLSLLRREARAPLGAPNPFHLQLHWASPLETLLDVLVAVLQAHAWEDVGLALCR
TQDPGGLVALWTSRAGRPPQLVLDLSRRDTGDAGLRARLAPMAAPVGGEAPVPAAVLLGC
DIARARRVLEAVPPGPHWLLGTPLPPKALPTAGLPPGLLALGEVARPPLEAAIHDIVQLV
ARALGSAAQVQPKRALLPAPVNCGDLQPAGPESPGRFLARFLANTSFQGRTGPVWVTGSS
QVHMSRHFKVWSLRRDPRGAPAWATVGSWRDGQLDLEPGGASARPPPPQGAQVWPKLRVV
TLLEHPFVFARDPDEDGQCPAGQLCLDPGTNDSATLDALFAALANGSAPRALRKCCYGYC
IDLLERLAEDTPFDFELYLVGDGKYGALRDGRWTGLVGDLLAGRAHMAVTSFSINSARSQ
VVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLGVFAALHLTALFLTVYEWRSP
YGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSY
TANLAAVMVGDKTFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRH
SAPTTPRGVAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQN
SPLTSNLSEFISRYKSSGFIDLLHDKWYKMVPCGKRVFAVTETLQMSIYHFAGLFVLLCL
GLGSALLSSLGEHAFFRLALPRIRKGSRLQYWLHTSQKIHRALNTEPPEGSKEETAEAEP
SGPEVEQQQQQQDQPTAPEGWKRARRAVDKERRVRFLLEPAVVVAPEADAEAEAAPREGP
VWLCSYGRPPAARPTGAPQPGELQELERRIEVARERLRQALVRRGQLLAQLGDSARHRPR
RLLQARAAPAEAPPHSGRPGSQE
NT seq 3132 nt   +upstreamnt  +downstreamnt
atggagtttgtgcgggcgctgtggctgggcctggcgctggcgctggggccggggtccgcg
gggggccaccctcagccgtgcggcgtcctggcgcgcctcgggggctccgtgcgcctgggc
gccctcctgccccgcgcgcctctcgcccgcgcccgcgcccgcgccgccctggcccgggcc
gccctggcgccgcggctgccgcacaacctgagcttggagctggtggtcgccgcgcccccc
gcccgcgaccccgcctcgctgacccgcggcctgtgccaggcgctggtgcctccgggcgtg
gcggccctgctcgcctttcccgaggctcggcccgagctgctgcagctgcacttcctggcg
gcggccaccgagacccccgtgctcagcctgctgcggcgggaggcgcgcgcgcccctcgga
gccccgaacccattccacctgcagctgcactgggccagccccctggagacgctgctggat
gtgctggtggcggtgctgcaggcgcacgcctgggaagacgtcggcctggccctgtgccgc
actcaggaccccggcggcctggtggccctctggacaagccgggctggccggcccccacag
ctggtcctggacctaagccggcgggacacgggagatgcaggactgcgggcacgcctggcc
ccgatggcggcgccagtggggggtgaagcaccggtacccgcggcggtcctcctcggctgt
gacatcgcccgtgcccgtcgggtgctggaggccgtacctcccggcccccactggctgttg
gggacaccactgccgcccaaggccctgcccaccgcggggctgccaccagggctgctggcg
ctgggcgaggtggcacgacccccgctggaggccgccatccatgacattgtgcaactggtg
gcccgggcgctgggcagtgcggcccaggtgcagccgaagcgagccctcctccccgccccg
gtcaactgcggggacctgcagccggccgggcccgagtccccggggcgcttcttggcacgg
ttcctggccaacacgtccttccagggccgcacgggccccgtgtgggtgacaggcagctcc
caggtacacatgtctcggcactttaaggtgtggagccttcgccgggacccacggggcgcc
ccggcctgggccacggtgggcagctggcgggacggccagctggacttggaaccgggaggt
gcctctgcacggcccccgcccccacagggtgcccaggtctggcccaagctgcgtgtggta
acgctgttggaacacccatttgtgtttgcccgtgatccagacgaagacgggcagtgccca
gcggggcagctgtgcctggaccctggcaccaacgactcggccaccctggacgcactgttc
gccgcgctggccaacggctcagcgccccgtgccctgcgcaagtgctgctacggctactgc
attgacctgctggagcggctggcggaggacacgcccttcgacttcgagctgtacctcgtg
ggtgacggcaagtacggcgccctgcgggacggccgctggaccggcctggtcggggacctg
ctggccggccgggcccacatggcggtcaccagcttcagtatcaactccgcccgctcacag
gtggtggacttcaccagccccttcttctccaccagcctgggcatcatggtgcgggcacgg
gacacggcctcacccatcggtgcctttatgtggcccctgcactggtccacgtggctgggc
gtctttgcggccctgcacctcaccgcgctcttcctcaccgtgtacgagtggcgtagcccc
tacggcctcacgccacgtggccgcaaccgcagcaccgtcttctcctactcctcagccctc
aacctgtgctacgccatcctcttcagacgcaccgtgtccagcaagacgcccaagtgcccc
acgggccgcctgctcatgaacctctgggccatcttctgcctgctggtgctgtccagctac
acggccaacctggctgccgtcatggtcggggacaagaccttcgaggagctgtcggggatc
cacgaccccaagctgcaccacccggcgcagggcttccgcttcggcaccgtgtgggagagc
agcgccgaggcgtacatcaagaagagcttccccgacatgcacgcacacatgcggcgccac
agcgcgcccaccacgccccgcggcgtcgccatgctcacgagcgacccccccaagctcaac
gccttcatcatggacaagtcgctcctggactacgaggtctccatcgacgccgactgcaaa
ctgctgaccgtgggaaagcccttcgccattgagggctatgggatcggactgccccagaac
tcgccgctcacctccaacctgtccgagttcatcagccgctacaagtcctccggcttcatc
gacctgctccacgacaagtggtacaagatggtgccttgcggcaagcgggtctttgcggtt
acagagaccctgcagatgagcatctaccacttcgcgggcctcttcgtgttgctgtgcctg
ggcctgggcagcgctctgctcagctcgctgggcgagcacgccttcttccgcctggcgctg
ccgcgcatccgcaaggggagcaggctgcagtactggctgcacaccagccagaaaatccac
cgcgccctcaacacggagccaccagaggggtcgaaggaggagacggcagaggcggagccc
agcggccccgaggtggagcagcagcagcagcagcaggaccagccaacggctccggagggc
tggaaacgggcgcgccgggccgtggacaaggagcgccgcgtgcgcttcctgctggagccc
gccgtggttgtggcacccgaagcggacgcggaggcggaggctgcgccgcgagagggcccc
gtctggctgtgctcctacggccgcccgcccgccgcaaggcccacgggggccccccagccc
ggggagctgcaggagctggagcgccgcatcgaagtcgcgcgtgagcggctccgccaggcc
ctggtgcggcgcggccagctcctggcacagctcggggacagcgcacgtcaccggcctcgg
cgcttgcttcaggccagagcggcccccgcggaggccccaccacactctggccgaccgggg
agccaggaatga

KEGG   Homo sapiens (human): 2890
Entry
2890              CDS       T01001                                 
Symbol
GRIA1, GLUH1, GLUR1, GLURA, GluA1, HBGR1, MRD67, MRT76
Name
(RefSeq) glutamate ionotropic receptor AMPA type subunit 1
  KO
K05197  glutamate receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05031  Amphetamine addiction
hsa05033  Nicotine addiction
Drug target
Dasolampanel: D10107
Dasolampanel etibutil: D10108
Dasolampanel etibutil tosylate: D10109
Farampator: D04131
Mibampator: D09931
Perampanel (DG01901): D08964 D10780<JP/US>
Pesampator: D12239
Riluzole: D00775<JP/US>
Talampanel: D02696
Tezampanel: D06656
Topiramate: D00537<JP/US>
Troriluzole (DG03011): D11414 D11415
Zonampanel: D09035
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2890 (GRIA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2890 (GRIA1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2890 (GRIA1)
   04728 Dopaminergic synapse
    2890 (GRIA1)
   04720 Long-term potentiation
    2890 (GRIA1)
   04730 Long-term depression
    2890 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    2890 (GRIA1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2890 (GRIA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    2890 (GRIA1)
   05016 Huntington disease
    2890 (GRIA1)
   05017 Spinocerebellar ataxia
    2890 (GRIA1)
   05022 Pathways of neurodegeneration - multiple diseases
    2890 (GRIA1)
  09165 Substance dependence
   05031 Amphetamine addiction
    2890 (GRIA1)
   05033 Nicotine addiction
    2890 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2890 (GRIA1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2890 (GRIA1)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6 DUF2061
Other DBs
NCBI-GeneID: 2890
NCBI-ProteinID: NP_000818
OMIM: 138248
HGNC: 4571
Ensembl: ENSG00000155511
Pharos: P42261(Tclin)
UniProt: P42261 Q59GL5
Structure
LinkDB
Position
5:153489615..153813869
AA seq 906 aa
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccggtttcctaggcgcggtagtaggtgccaat
ttccccaacaatatccagatcgggggattatttccaaaccagcagtcacaggaacatgct
gcttttagatttgctttgtcgcaactcacagagcccccgaagctgctcccccagattgat
attgtgaacatcagcgacagctttgagatgacctatagattctgttcccagttctccaaa
ggagtctatgccatctttgggttttatgaacgtaggactgtcaacatgctgacctccttt
tgtggggccctccacgtctgcttcattacgccgagctttcccgttgatacatccaatcag
tttgtccttcagctgcgccctgaactgcaggatgccctcatcagcatcattgaccattac
aagtggcagaaatttgtctacatttatgatgccgaccggggcttatccgtcctgcagaaa
gtcctggatacagctgctgagaagaactggcaggtgacagcagtcaacattttgacaacc
acagaggagggataccggatgctctttcaggacctggagaagaaaaaggagcggctggtg
gtggtggactgtgaatcagaacgcctcaatgctatcttgggccagattataaagctagag
aagaatggcatcggctaccactacattcttgcaaatctgggcttcatggacattgactta
aacaaattcaaggagagtggcgccaatgtgacaggtttccagctggtgaactacacagac
actattccggccaagatcatgcagcagtggaagaatagtgatgctcgagaccacacacgg
gtggactggaagagacccaagtacacctctgcgctcacctacgatggggtgaaggtgatg
gctgaggctttccagagcctgcggaggcagagaattgatatatctcgccgggggaatgct
ggggattgtctggctaacccagctgttccctggggccaagggatcgacatccagagagct
ctgcagcaggtgcgatttgaaggtttaacaggaaacgtgcagtttaatgagaaaggacgc
cggaccaactacacgctccacgtgattgaaatgaaacatgacggcatccgaaagattggt
tactggaatgaagatgataagtttgtccctgcagccaccgatgcccaagctgggggcgat
aattcaagtgttcagaacagaacatacatcgtcacaacaatcctagaagatccttatgtg
atgctcaagaagaacgccaatcagtttgagggcaatgaccgttacgagggctactgtgta
gagctggcggcagagattgccaagcacgtgggctactcctaccgtctggagattgtcagt
gatggaaaatacggagcccgagaccctgacacgaaggcctggaatggcatggtgggagag
ctggtctatggaagagcagatgtggctgtggctcccttaactatcactttggtccgggaa
gaagttatagatttctccaaaccatttatgagtttggggatctccatcatgattaaaaaa
ccacagaaatccaagccgggtgtcttctccttccttgatcctttggcttatgagatttgg
atgtgcattgtttttgcctacattggagtgagtgttgtcctcttcctggtcagccgcttc
agtccctatgaatggcacagtgaagagtttgaggaaggacgggaccagacaaccagtgac
cagtccaatgagtttgggatattcaacagtttgtggttctccctgggagccttcatgcag
caaggatgtgacatttctcccaggtccctgtctggtcgcatcgttggtggcgtctggtgg
ttcttcaccttaatcatcatctcctcatatacagccaatctggccgccttcctgaccgtg
gagaggatggtgtctcccattgagagtgcagaggacctagcgaagcagacagaaattgcc
tacgggacgctggaagcaggatctactaaggagttcttcaggaggtctaaaattgctgtg
tttgagaagatgtggacatacatgaagtcagcagagccatcagtttttgtgcggaccaca
gaggaggggatgattcgagtgaggaaatccaaaggcaaatatgcctacctcctggagtcc
accatgaatgagtacattgagcagcggaaaccctgtgacaccatgaaggtgggaggtaac
ttggattccaaaggctatggcattgcaacacccaaggggtctgccctgagaaatccagta
aacctggcagtgttaaaactgaacgagcaggggcttttggacaaattgaaaaacaaatgg
tggtacgacaagggcgagtgcggcagcgggggaggtgattccaaggacaagacaagcgct
ctgagcctcagcaatgtggcaggcgtgttctacatcctgatcggaggacttggactagcc
atgctggttgccttaatcgagttctgctacaaatcccgtagtgaatccaagcggatgaag
ggtttttgtttgatcccacagcaatccatcaacgaagccatacggacatcgaccctcccc
cgcaacagcggggcaggagccagcagcggcggcagtggagagaatggtcgggtggtcagc
catgacttccccaagtccatgcaatcgattccttgcatgagccacagttcagggatgccc
ttgggagccacgggattgtaa

KEGG   Homo sapiens (human): 2891
Entry
2891              CDS       T01001                                 
Symbol
GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2, NEDLIB, gluR-2, gluR-B
Name
(RefSeq) glutamate ionotropic receptor AMPA type subunit 2
  KO
K05198  glutamate receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05033  Nicotine addiction
Disease
H02397  Neurodevelopmental disorder with movement abnormalities or hypotonia
Drug target
Dasolampanel: D10107
Dasolampanel etibutil: D10108
Dasolampanel etibutil tosylate: D10109
Farampator: D04131
Mibampator: D09931
Perampanel (DG01901): D08964 D10780<JP/US>
Pesampator: D12239
Riluzole: D00775<JP/US>
Talampanel: D02696
Tezampanel: D06656
Topiramate: D00537<JP/US>
Troriluzole (DG03011): D11414 D11415
Zonampanel: D09035
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2891 (GRIA2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2891 (GRIA2)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2891 (GRIA2)
   04728 Dopaminergic synapse
    2891 (GRIA2)
   04720 Long-term potentiation
    2891 (GRIA2)
   04730 Long-term depression
    2891 (GRIA2)
   04723 Retrograde endocannabinoid signaling
    2891 (GRIA2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2891 (GRIA2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    2891 (GRIA2)
   05016 Huntington disease
    2891 (GRIA2)
   05017 Spinocerebellar ataxia
    2891 (GRIA2)
   05022 Pathways of neurodegeneration - multiple diseases
    2891 (GRIA2)
  09165 Substance dependence
   05030 Cocaine addiction
    2891 (GRIA2)
   05031 Amphetamine addiction
    2891 (GRIA2)
   05033 Nicotine addiction
    2891 (GRIA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2891 (GRIA2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2891 (GRIA2)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6 DUF2061
Other DBs
NCBI-GeneID: 2891
NCBI-ProteinID: NP_000817
OMIM: 138247
HGNC: 4572
Ensembl: ENSG00000120251
Pharos: P42262(Tclin)
UniProt: P42262
Structure
LinkDB
Position
4:157220120..157366075
AA seq 883 aa
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGVL
DKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgcaaaagattatgcatatttctgtcctcctttctcctgttttatggggactgattttt
ggtgtctcttctaacagcatacagataggggggctatttcctaggggcgccgatcaagaa
tacagtgcatttcgagtagggatggttcagttttccacttcggagttcagactgacaccc
cacatcgacaatttggaggtggcaaacagcttcgcagtcactaatgctttctgctcccag
ttttcgagaggagtctatgctatttttggattttatgacaagaagtctgtaaataccatc
acatcattttgcggaacactccacgtctccttcatcactcccagcttcccaacagatggc
acacatccatttgtcattcagatgagacccgacctcaaaggagctctccttagcttgatt
gaatactatcaatgggacaagtttgcatacctctatgacagtgacagaggcttatcaaca
ctgcaagctgtgctggattctgctgctgaaaagaaatggcaagtgactgctatcaatgtg
ggaaacattaacaatgacaagaaagatgagatgtaccgatcactttttcaagatctggag
ttaaaaaaggaacggcgtgtaattctggactgtgaaagggataaagtaaacgacattgta
gaccaggttattaccattggaaaacatgttaaagggtaccactacatcattgcaaatctg
ggatttactgatggagacctattaaaaatccagtttggaggtgcaaatgtctctggattt
cagatagtggactatgatgattcgttggtatctaaatttatagaaagatggtcaacactg
gaagaaaaagaataccctggagctcacacaacaacaattaagtatacttctgctctgacc
tatgatgccgttcaagtgatgactgaagccttccgcaacctaaggaagcaaagaattgaa
atctcccgaagggggaatgcaggagactgtctggcaaacccagcagtgccctggggacaa
ggtgtagaaatagaaagggccctcaaacaggttcaggttgaaggtctctcaggaaatata
aagtttgaccagaatggaaaaagaataaactatacaattaacatcatggagctcaaaact
aatgggccccggaagattggctactggagtgaagtggacaaaatggttgttacccttact
gagctcccttctggaaatgacacctctgggcttgagaataagactgttgttgtcaccaca
attttggaatctccgtatgttatgatgaagaaaaatcatgaaatgcttgaaggcaatgag
cgctatgagggctactgtgttgacctggctgcagaaatcgccaaacattgtgggttcaag
tacaagttgacaattgttggtgatggcaagtatggggccagggatgcagacacgaaaatt
tggaatgggatggttggagaacttgtatatgggaaagctgatattgcaattgctccatta
actattacccttgtgagagaagaggtgattgacttctcaaagcccttcatgagcctcggg
atatctatcatgatcaagaagcctcagaagtccaaaccaggagtgttttcctttcttgat
cctttagcctatgagatctggatgtgcattgtttttgcctacattggggtcagtgtagtt
ttattcctggtcagcagatttagcccctacgagtggcacactgaggagtttgaagatgga
agagaaacacaaagtagtgaatcaactaatgaatttgggatttttaatagtctctggttt
tccttgggtgcctttatgcagcaaggatgcgatatttcgccaagatccctctctgggcgc
attgttggaggtgtgtggtggttctttaccctgatcataatctcctcctacacggctaac
ttagctgccttcctgactgtagagaggatggtgtctcccatcgaaagtgctgaggatctt
tctaagcaaacagaaattgcttatggaacattagactctggctccactaaagagtttttc
aggagatctaaaattgcagtgtttgataaaatgtggacctacatgcggagtgcggagccc
tctgtgtttgtgaggactacggccgaaggggtggctagagtgcggaagtccaaagggaaa
tatgcctacttgttggagtccacgatgaacgagtacattgagcaaaggaagccttgcgac
accatgaaagttggtggaaacctggattccaaaggctatggcatcgcaacacctaaagga
tcctcattaagaaccccagtaaatcttgcagtattgaaactcagtgagcaaggcgtctta
gacaagctgaaaaacaaatggtggtacgataaaggtgaatgtggagccaaggactctgga
agtaaggaaaagaccagtgccctcagtctgagcaacgttgctggagtattctacatcctt
gtcgggggccttggtttggcaatgctggtggctttgattgagttctgttacaagtcaagg
gccgaggcgaaacgaatgaaggtggcaaagaatgcacagaatattaacccatcttcctcg
cagaattcacagaattttgcaacttataaggaaggttacaacgtatatggcatcgaaagt
gttaaaatttag

KEGG   Homo sapiens (human): 2892
Entry
2892              CDS       T01001                                 
Symbol
GRIA3, GLUR-C, GLUR-K3, GLUR3, GLURC, GluA3, MRX94, MRXSW
Name
(RefSeq) glutamate ionotropic receptor AMPA type subunit 3
  KO
K05199  glutamate receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05031  Amphetamine addiction
hsa05033  Nicotine addiction
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00120  MLL-ENL fusion to transcriptional activation
Disease
H00658  X-linked syndromic intellectual developmental disorder
Drug target
Dasolampanel: D10107
Dasolampanel etibutil: D10108
Dasolampanel etibutil tosylate: D10109
Farampator: D04131
Mibampator: D09931
Perampanel (DG01901): D08964 D10780<JP/US>
Pesampator: D12239
Riluzole: D00775<JP/US>
Talampanel: D02696
Tezampanel: D06656
Topiramate: D00537<JP/US>
Troriluzole (DG03011): D11414 D11415
Zonampanel: D09035
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2892 (GRIA3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2892 (GRIA3)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2892 (GRIA3)
   04728 Dopaminergic synapse
    2892 (GRIA3)
   04730 Long-term depression
    2892 (GRIA3)
   04723 Retrograde endocannabinoid signaling
    2892 (GRIA3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2892 (GRIA3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    2892 (GRIA3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    2892 (GRIA3)
   05017 Spinocerebellar ataxia
    2892 (GRIA3)
   05022 Pathways of neurodegeneration - multiple diseases
    2892 (GRIA3)
  09165 Substance dependence
   05031 Amphetamine addiction
    2892 (GRIA3)
   05033 Nicotine addiction
    2892 (GRIA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2892 (GRIA3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2892 (GRIA3)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 NusG_add DUF2061
Other DBs
NCBI-GeneID: 2892
NCBI-ProteinID: NP_000819
OMIM: 305915
HGNC: 4573
Ensembl: ENSG00000125675
Pharos: P42263(Tclin)
UniProt: P42263 Q17R51
LinkDB
Position
X:123184278..123490915
AA seq 894 aa
MARQKKMGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNT
NQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGAL
HTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEA
AVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHS
RGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKN
APLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKM
VQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASS
ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKY
GARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKS
KPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPP
NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVER
MVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTAD
GVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNL
AVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMM
VALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
NT seq 2685 nt   +upstreamnt  +downstreamnt
atggccaggcagaagaaaatggggcaaagcgtgctccgggcggtcttctttttagtcctg
gggcttttgggtcattctcacggaggattccccaacaccatcagcataggtggacttttc
atgagaaacacagtgcaggagcacagcgctttccgctttgccgtgcagttatacaacacc
aaccagaacaccaccgagaagcccttccatttgaattaccacgtagatcacttggattcc
tccaatagtttttccgtgacaaatgctttctgctcccagttctcgagaggggtgtatgcc
atctttggattctatgaccagatgtcaatgaacaccctgacctccttctgtggggccctg
cacacatcctttgttacgcctagcttccccactgacgcagatgtgcagtttgtcatccag
atgcgcccagccttgaagggcgctattctgagtcttctgggtcattacaagtgggagaag
tttgtgtacctctatgacacagaacgaggattttccatcctccaagcgattatggaagca
gcagtgcaaaacaactggcaagtaacagcaaggtctgtgggaaacataaaggacgtccaa
gaattcaggcgcatcattgaagaaatggacaggaggcaggaaaagcgatacttgattgac
tgcgaagtcgaaaggattaacacaattttggaacaggttgtgatcctagggaaacactca
agaggttatcactacatgctcgctaacctgggttttactgatattttactggaaagagtc
atgcatgggggagccaacattacaggtttccagattgtcaacaatgaaaaccctatggtt
cagcagttcatacagcgctgggtgaggctggatgaaagggaattccctgaagccaagaat
gcaccactaaagtatacatctgcattgacacacgacgcaatactggtcatagcagaagct
ttccgctacctgaggaggcagcgagtagatgtgtcccggagaggaagtgctggagactgc
ttagcaaatcctgctgtgccctggagtcaaggaattgatattgagagagctctgaaaatg
gtgcaagtacaaggaatgactggaaatattcaatttgacacttatggacgtaggacaaat
tataccatcgatgtgtatgaaatgaaagtcagtggctctcgaaaagctggctactggaat
gagtatgaaaggtttgtgcctttctcagatcagcaaatcagcaatgacagtgcatcctca
gagaatcggaccatagtagtgactaccattctggaatcaccatatgtaatgtacaagaag
aaccatgagcaactggaaggaaatgaacgatatgaaggctattgtgtagacctagcctat
gaaatagccaaacatgtaaggatcaaatacaaattgtccatcgttggtgacgggaaatat
ggtgcaagggatccagagactaaaatatggaacggcatggttggggaacttgtctatggg
agagctgatatagctgttgctccactcactataacattggtccgtgaagaagtcatagat
ttttcaaagccattcatgagcctgggcatctccatcatgataaagaagcctcagaaatca
aaaccaggcgtattctcatttctggatcccctggcttatgaaatctggatgtgcattgtc
tttgcttacattggagtcagcgtagttcttttcctagtcagcaggttcagtccttatgaa
tggcacttggaagacaacaatgaagaacctcgtgacccacaaagtcctcctgatcctcca
aatgaatttggaatatttaacagtctttggttttccttgggtgcctttatgcagcaagga
tgtgatatttctccaagatcactctccgggcgcattgttggaggggtttggtggttcttc
accctgatcataatttcttcctatactgccaatctcgctgctttcctgactgtggagagg
atggtttctcccatagagagtgctgaagacttagctaaacagactgaaattgcatatggg
accctggactccggttcaacaaaagaatttttcagaagatccaaaattgctgtgtacgag
aaaatgtggtcttacatgaaatcagcggagccatctgtgtttaccaaaacaacagcagac
ggagtggcccgagtgcgaaagtccaagggaaagttcgccttcctgctggagtcaaccatg
aatgagtacattgagcagagaaaaccatgtgatacgatgaaagttggtggaaatctggat
tccaaaggctatggtgtggcaacccctaaaggctcagcattaagaaatgctgttaacctg
gcagtattaaaactgaatgagcaaggcctcttggacaaattgaaaaacaaatggtggtac
gacaaaggagagtgcggcagcgggggcggtgactccaaggacaagaccagcgctctgagc
ctgagcaatgtggcaggcgttttctatatacttgtcggaggtctggggctggccatgatg
gtggctttgatagaattctgttacaaatcacgggcagagtccaaacgcatgaaactcaca
aagaacacccaaaactttaagcctgctcctgccaccaacactcagaattatgctacatac
agagaaggctacaacgtgtatggaacagagagtgttaagatctag

KEGG   Homo sapiens (human): 2893
Entry
2893              CDS       T01001                                 
Symbol
GRIA4, GLUR4, GLUR4C, GLURD, GluA4, GluA4-ATD, NEDSGA
Name
(RefSeq) glutamate ionotropic receptor AMPA type subunit 4
  KO
K05200  glutamate receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05031  Amphetamine addiction
hsa05033  Nicotine addiction
Disease
H02397  Neurodevelopmental disorder with movement abnormalities or hypotonia
Drug target
Dasolampanel: D10107
Dasolampanel etibutil: D10108
Dasolampanel etibutil tosylate: D10109
Farampator: D04131
Mibampator: D09931
Perampanel (DG01901): D08964 D10780<JP/US>
Pesampator: D12239
Riluzole: D00775<JP/US>
Talampanel: D02696
Tezampanel: D06656
Topiramate: D00537<JP/US>
Troriluzole (DG03011): D11414 D11415
Zonampanel: D09035
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2893 (GRIA4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2893 (GRIA4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2893 (GRIA4)
   04728 Dopaminergic synapse
    2893 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    2893 (GRIA4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2893 (GRIA4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    2893 (GRIA4)
   05022 Pathways of neurodegeneration - multiple diseases
    2893 (GRIA4)
  09165 Substance dependence
   05031 Amphetamine addiction
    2893 (GRIA4)
   05033 Nicotine addiction
    2893 (GRIA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2893 (GRIA4)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2893 (GRIA4)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6 DUF2061
Other DBs
NCBI-GeneID: 2893
NCBI-ProteinID: NP_000820
OMIM: 138246
HGNC: 4574
Ensembl: ENSG00000152578
Pharos: P48058(Tclin)
UniProt: P48058 Q1WWK6
LinkDB
Position
11:105609616..105982090
AA seq 902 aa
MRIISRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP
NT seq 2709 nt   +upstreamnt  +downstreamnt
atgaggattatttccagacagattgtcttgttattttctggattttggggactcgccatg
ggagcctttccgagcagcgtgcaaataggtggtctcttcatccgaaacacagatcaggaa
tacactgcttttcgattagcaatttttcttcataacaccagccccaatgcgtcggaagct
ccttttaatttggtacctcatgtggacaacattgagacagccaacagttttgctgtaaca
aacgccttctgttcccagtattctagaggagtatttgccatttttggactctatgataag
aggtcggtacataccttgacctcattctgcagcgccttacatatctccctcatcacacca
agtttccctactgagggggagagccagtttgtgctgcaactaagaccttcgttacgagga
gcactcttgagtttgctggatcactacgaatggaactgttttgtcttcctgtatgacaca
gacaggggatactcgatactccaagctattatggaaaaagcaggacaaaatggttggcat
gtcagcgctatatgtgtggaaaattttaatgatgtcagctataggcaacttctagaagaa
cttgacagaagacaagagaagaagtttgtaatagactgtgagatagagagacttcaaaac
atattagaacagattgtaagtgttggaaagcatgttaaaggctaccattatatcattgca
aacttgggattcaaggatatttctcttgagaggtttatacatggtggagccaatgttact
ggattccagttggtggattttaatacacctatggtaatcaaactaatggatcgctggaag
aaactagatcagagagagtatccaggatctgagactcctccaaagtacacctctgctctg
acttatgatggagtccttgtgatggctgaaactttccgaagtcttaggaggcagaaaatt
gatatctcaaggagaggaaatgctggggattgtctggcaaatcctgctgctccatggggc
cagggaattgacatggagaggacactcaaacaggttcgaattcaagggctgacagggaat
gttcagtttgaccactatggacgtagagtcaattacacaatggatgtgtttgagctgaaa
agcacaggacctagaaaggttggttactggaatgatatggataagttagtcttgattcaa
gatgtaccaactcttggcaatgacacagctgctattgagaacagaacagtggttgtaacc
acaattatggaatccccatatgttatgtacaagaaaaatcatgaaatgtttgaaggaaat
gacaagtatgaaggatactgtgtagatttggcatctgaaattgcaaaacatattggtatc
aagtataaaattgccattgtccctgatggaaaatatggagcaagggatgcagacacaaaa
atctggaatgggatggtaggagaacttgtttatgggaaagcagagattgctattgcccct
ctgacaatcactttggtacgagaggaggtcattgacttttctaagcccttcatgagtttg
ggcatatctatcatgatcaaaaagcctcagaaatccaaaccaggagtgttttccttcttg
gatcctctggcctatgagatttggatgtgcatagtctttgcctacattggtgtcagcgtg
gtcttattcctagttagtagatttagtccatatgagtggcacacagaagagccagaggac
ggaaaggaaggacccagcgaccagcctcccaatgagtttggcatctttaacagcctctgg
ttttccctgggtgcttttatgcagcaaggatgtgacatttcacccagatccctctcaggt
cgaattgttggaggtgtttggtggttctttacactcatcattatatcatcttatactgct
aacctcgctgctttcctgacggttgagcgaatggtctctcccatagaaagtgcagaagac
ctggccaaacaaacagaaattgcctatggaacactggattcaggatcaacaaaagaattc
ttcagaagatcaaaaatagcagtgtatgaaaagatgtggacctacatgcgatcagcagag
ccatcagtattcactaggactacagctgagggagtagctcgtgtccgcaaatccaagggc
aaatttgcctttctcctggagtccactatgaatgaatacattgagcagcgaaagccatgt
gacacgatgaaagtgggaggaaatctggattccaaaggctatggagtagcaacgcccaag
ggttcctcattaagaactcctgtaaaccttgccgttttgaaactcagtgaggcaggcgtc
ttagacaagctgaaaaacaaatggtggtacgataaaggtgaatgtggacccaaggactct
ggaagcaaggacaagacgagtgccttgagcctgagcaatgtagcaggcgtcttctacatt
ctggttggcggcttgggcttggcaatgctggtggctttgatagagttctgttacaagtcc
agggcagaagcgaagagaatgaagctgaccttttctgaagccataagaaacaaagccaga
ttatccatcactgggagtgtgggagagaatggccgcgtcttgacgcctgactgcccaaag
gctgtacacactggaactgcaatcagacaaagttcaggattggctgtcattgcatcggac
ctaccataa

KEGG   Homo sapiens (human): 2894
Entry
2894              CDS       T01001                                 
Symbol
GRID1, GluD1, GluD1-b
Name
(RefSeq) glutamate ionotropic receptor delta type subunit 1
  KO
K05206  glutamate receptor delta-1 subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2894 (GRID1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2894 (GRID1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2894 (GRID1)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Other DBs
NCBI-GeneID: 2894
NCBI-ProteinID: NP_060021
OMIM: 610659
HGNC: 4575
Ensembl: ENSG00000182771
Pharos: Q9ULK0(Tbio)
UniProt: Q9ULK0 A8KAN9
LinkDB
Position
10:complement(85599552..86366795)
AA seq 1009 aa
MEALTLWLLPWICQCVSVRADSIIHIGAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKI
TYSIKVIEANNPFQAVQEACDLMTQGILALVTSTGCASANALQSLTDAMHIPHLFVQRNP
GGSPRTACHLNPSPDGEAYTLASRPPVRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQS
FLDQASRLGLDVSLQKVDKNISHVFTSLFTTMKTEELNRYRDTLRRAILLLSPQGAHSFI
NEAVETNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCTRNNHR
ISSLLCDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWN
GGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKG
LNGSLQERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGF
KYEIYQAPDGRYGHQLHNTSWNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYS
VGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPS
ASATLHSAIWIVYGAFVQQGGESSVNSMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSR
MDNPIRTFQDLSKQVEMSYGTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADN
CVSSPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPY
RDLFSQRILELQDTGDLDVLKQKWWPHMGRCDLTSHASAQADGKSLKLHSFAGVFCILAI
GLLLACLVAALELWWNSNRCHQETPKEDKEVNLEQVHRRMNSLMDEDIAHKQISPASIEL
SALEMGGLAPTQTLEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSGPSSNLPLPLSSSAT
MPSMQCKHRSPNGGLFRQSPVKTPIPMSFQPVPGGVLPEALDTSHGTSI
NT seq 3030 nt   +upstreamnt  +downstreamnt
atggaagcgctgacgctgtggcttctcccctggatatgccagtgcgtgtcggtgcgggcc
gactccatcatccacatcggtgccatcttcgaggagaacgcggccaaggacgacagggtg
ttccagttggcggtatccgacctgagcctcaacgatgacatcctgcagagcgagaagatc
acctactccatcaaggtcatcgaggccaacaacccattccaggctgtgcaggaagcctgt
gacctcatgacccaggggattttggccttggtcacgtccactggctgtgcatctgccaat
gccctgcagtccctcacggatgccatgcacatcccacacctctttgtccagcgcaacccg
ggagggtcgccacgcaccgcatgccacctgaaccccagccccgatggtgaggcctacaca
ctggcttcgagaccacccgtccgcctcaatgatgtcatgctcaggctggtgacggagctg
cgctggcagaagttcgtcatgttctacgacagcgagtatgatatccgtgggcttcaaagc
tttctggaccaggcctcgcggctgggccttgacgtctctttacaaaaggtggacaagaac
attagccacgtattcaccagcctcttcaccacgatgaagacagaggagctgaatcgctac
cgggacacgcttcgccgcgccatcctgctgctcagcccacagggagcccactccttcatc
aacgaggccgtggagaccaacctggcttccaaggacagccactgggtctttgtgaatgag
gaaatcagtgacccggagatcctggatctggtccatagtgcccttggaaggatgaccgtg
gtccggcaaatctttccgtctgcaaaggacaatcagaaatgcacgaggaacaaccaccgc
atctcctccctgctctgcgacccccaggaaggctacctccagatgctgcagatctccaac
ctctatctgtatgacagtgttctgatgctggccaacgcctttcacaggaagctggaggac
cggaagtggcatagcatggcgagcctcaactgcatacggaaatccactaagccatggaat
ggtgggaggtccatgctggataccatcaaaaagggccacatcactggcctcactggggtg
atggagtttcgggaggacagttcgaatccctatgtccagtttgaaatccttggcactacc
tatagtgagacttttggcaaagacatgcgcaagttggcgacatgggactcagagaagggc
ttgaatggcagcttgcaagagaggcccatgggcagccgcctccaaggattgactcttaaa
gtggtgactgtcttggaagagcctttcgtgatggtggctgagaacatcctaggacagccc
aagcgctacaaagggttctccatagatgtcctggatgcactggccaaggctctgggcttt
aaatatgagatttaccaagcccctgatggcaggtacggtcaccagctccataacacctcc
tggaacgggatgatcggggagctcatcagcaagagagcagacttggccatctctgccatc
accatcaccccagagagggagagcgttgtggacttcagcaagcggtacatggactattca
gtggggattctaattaagaagcccgaggagaaaatcagcatcttctccctctttgctcca
tttgatttcgctgtgtgggcctgcattgcagcagccatccctgtggttggtgtgctgata
tttgtgttgaacaggatacaggctgtgagggctcagagtgctgcccagcccaggccgtca
gcttctgccactctgcacagcgccatctggattgtctatggagccttcgtacagcaaggt
ggcgaatcttccgtgaactccatggccatgcgcatcgtgatgggcagctggtggctcttc
acgctcattgtgtgctcctcctacacagccaaccttgctgccttcctcacagtgtccagg
atggacaaccccataaggactttccaggacctgtccaaacaagtggaaatgtcttatggc
actgtccgggattctgctgtatatgagtacttccgagccaagggcaccaaccccctggag
caggacagcacgtttgctgaactctggcggaccatcagcaagaacggaggggctgacaac
tgcgtgtccagtccttcagaaggcatcaggaaggcaaagaaggggaactacgccttcctg
tgggatgtggccgtggtggaatacgcagccctgacggatgacgactgctcggtgactgtc
atcggcaacagcatcagcagcaagggttacgggattgccctgcagcatggcagcccctac
agggacctcttctcccagaggatcctggagctgcaggacacaggggacctggatgtgctg
aagcagaagtggtggccgcacatgggccgctgtgacctcaccagccatgccagcgcccag
gccgacggcaaatccctcaagctgcacagcttcgccggggtcttctgcatcctggccatt
ggcctgctcctggcctgcctggtggctgccctggagttgtggtggaacagcaaccggtgc
caccaggagacccccaaggaggacaaagaagtgaacttggagcaggtccaccggcgcatg
aacagcctcatggatgaagacattgctcacaagcagatttccccagcgtcgattgagctc
tcggccctggagatggggggcctggctcccacccagaccttggagccgacacgggagtac
cagaacacccagctctcggtcagcacctttctgccagagcagagcagccatggcaccagc
cggacactctcatcagggcccagcagcaacctgccgctgccgctgagcagctcggcgacc
atgccctccatgcagtgcaaacacaggtcacccaacggggggctgttccggcagagcccg
gtgaagacccccatccccatgtccttccagcccgtgcctggaggcgtccttccagaggct
ctggacacctcccacgggacctccatctga

KEGG   Homo sapiens (human): 2895
Entry
2895              CDS       T01001                                 
Symbol
GRID2, GluD2, SCAR18
Name
(RefSeq) glutamate ionotropic receptor delta type subunit 2
  KO
K05207  glutamate receptor delta-2 subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04730  Long-term depression
Disease
H01891  Autosomal recessive spinocerebellar ataxias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2895 (GRID2)
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    2895 (GRID2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2895 (GRID2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2895 (GRID2)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Desmo_N DUF6724 RNase_H
Other DBs
NCBI-GeneID: 2895
NCBI-ProteinID: NP_001501
OMIM: 602368
HGNC: 4576
Ensembl: ENSG00000152208
Pharos: O43424(Tbio)
UniProt: O43424
Structure
LinkDB
Position
4:92303966..93810456
AA seq 1007 aa
MEVFPFLLVLSVWWSRTWDSANADSIIHIGAIFDESAKKDDEVFRTAVGDLNQNEEILQT
EKITFSVTFVDGNNPFQAVQEACELMNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQ
RSTAGTPRSGCGLTRSNRNDDYTLSVRPPVYLHDVILRVVTEYAWQKFIIFYDSEYDIRG
IQEFLDKVSQQGMDVALQKVENNINKMITTLFDTMRIEELNRYRDTLRRAILVMNPATAK
SFITEVVETNLVAFDCHWIIINEEINDVDVQELVRRSIGRLTIIRQTFPVPQNISQRCFR
GNHRISSTLCDPKDPFAQNMEISNLYIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNS
KPWQGGRSMLETIKKGGVSGLTGELEFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWN
PVTGLNGSLTDKKLENNMRGVVLRVVTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSN
YLGFNYEIYVAPDHKYGSPQEDGTWNGLVGELVFKRADIGISALTITPDRENVVDFTTRY
MDYSVGVLLRRAEKTVDMFACLAPFDLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSM
TSTTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGAWWLFALIVISSYTANLAAFLTITR
IESSIQSLQDLSKQTEIPYGTVLDSAVYEHVRMKGLNPFERDSMYSQMWRMINRSNGSEN
NVLESQAGIQKVKYGNYAFVWDAAVLEYVAINDPDCSFYTIGNTVADRGYGIALQHGSPY
RDVFSQRILELQQNGDMDILKHKWWPKNGQCDLYSSVDTKQKGGALDIKSFAGVFCILAA
GIVLSCFIAMLETWWNKRKGSRVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSI
DLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEH
RTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI
NT seq 3024 nt   +upstreamnt  +downstreamnt
atggaagttttcccctttctcttggttttgtccgtctggtggtctcgaacctgggactcg
gcgaatgcggattcgatcattcacatcggagcaatttttgatgaatctgccaaaaaggat
gatgaggtatttcgcactgcggttggtgaccttaaccagaatgaggagatcttacagact
gagaaaatcacattttcagtgacgtttgttgatggcaacaaccctttccaagcagttcaa
gaagcctgtgaacttatgaatcaaggcatcttggccctggtcagctccattggctgcacg
tcagcaggatccctccagtctttggcagacgccatgcatatcccccacctcttcattcag
cgctcaacagctgggaccccaaggagtggctgtggactcacccggagcaacaggaatgat
gactacactctctcagttcgcccacctgtctacttgcatgatgttatcctaagagtggtc
acagagtatgcctggcagaaattcattatattctatgatagtgaatacgatatccgtgga
atacaggagttcttggacaaagtctctcagcagggaatggatgttgcacttcagaaggta
gaaaacaacatcaataaaatgattaccactctctttgacaccatgagaatagaagaactg
aatcgctatcgagacactcttaggcgagcgatccttgttatgaatcctgctacagccaaa
tccttcattactgaggttgtggagactaatttggttgcttttgactgtcactggatcatt
ataaatgaggaaataaacgatgtggacgtacaggaacttgtaagaaggtcaattggaagg
ttaacgattattcggcagacatttccagttccccagaacataagtcagcggtgtttccgt
ggcaaccatcgaatatcttcaacattgtgtgatccaaaggatccatttgctcagaatatg
gagatttccaacctttacatatatgacacggtgcttctgcttgctaatgcttttcataag
aagctggaggaccgaaagtggcacagcatggcaagtctgtcatgtatcagaaagaactca
aagccctggcagggtgggcgctccatgttggagaccatcaagaagggtggagttagtggg
ttgactggagagctagaatttggagaaaatggaggcaatcccaatgtccactttgaaatc
cttggaaccaactatggagaagagcttggcagaggtgttcgaaaacttggttgctggaat
cctgtcacaggtctgaatgggtcactgactgacaagaaattggagaataacatgcgtgga
gtggttctacgtgtagtaactgttctggaagaaccttttgtgatggtctctgaaaatgtc
ttgggtaagccgaagaaataccagggcttctccattgatgttttggatgccttatctaac
tacctgggttttaactacgaaatttacgtagcaccggatcacaaatacggaagcccacaa
gaagatgggacatggaatggcttggtaggagaacttgtctttaagagagccgacataggg
atttctgctttaaccatcactccagatcgtgaaaatgtggtggactttacgacacgttac
atggactactcagtgggggtactacttcgaagggctgaaaagacagtggatatgtttgcc
tgtcttgcaccatttgatctctctctatgggcttgcattgctggcacagtccttctggtg
ggtctactggtctacctcttgaactggcttaatcccccacgattacaaatgggatcaatg
acgtctactactctctacaactccatgtggtttgtgtatggatcttttgtacaacaaggc
ggggaagtcccgtacacgactctggctacccgaatgatgatgggggcttggtggctattt
gctttgattgttatctcatcttacacggcaaacctcgctgctttcctcactattacacgc
attgaaagttccatccagtctctccaggacctttccaagcaaacagaaatcccttatggc
acagtcctagactctgcggtatatgagcatgtccgcatgaaaggactgaatccttttgag
agggacagcatgtattcccaaatgtggcggatgatcaaccgaagcaatggatcggagaac
aatgttctggagtcccaggcaggcattcaaaaggtaaaatatggaaattatgctttcgta
tgggatgcagctgtattggaatatgtggctatcaatgacccagattgttccttttacacc
attggaaatactgttgctgatcggggatatggaattgcattacaacatggcagtccttac
cgagatgttttttcacaaaggatcctggagcttcagcagaatggtgacatggacatcctg
aagcacaaatggtggcctaagaatggccagtgtgacctgtactcgtcagtggacacaaag
cagaaaggaggcgccctggacataaagagctttgcaggggtcttttgtatcctggctgct
ggaattgtcctctcctgcttcatagccatgctggagacgtggtggaacaagaggaaaggc
tcccgggttccatcaaaagaggatgacaaggaaattgacctggagcacctccatagacgt
gtaaatagcttgtgcacagatgacgacagcccccataaacagttttccacctcgtcaatt
gatttgacccctctggacattgacactttgccaacacgacaagcactggagcaaatcagt
gatttcaggaacactcatattaccacaacaacctttatcccagagcagatccagactctt
agccgcacactgtcagctaaagctgcttctggtttcacttttggcaacgtgcctgagcac
cgaactggcccttttaggcacagggcacctaatgggggctttttcaggagtcctataaaa
acaatgtcatctattccttatcaaccaactcctaccctggggctcaatctgggtaatgat
ccagaccgaggcacctccatatga

KEGG   Homo sapiens (human): 2897
Entry
2897              CDS       T01001                                 
Symbol
GRIK1, EAA3, EEA3, GLR5, GLUR5, GluK1, gluR-5
Name
(RefSeq) glutamate ionotropic receptor kainate type subunit 1
  KO
K05201  glutamate receptor, ionotropic kainate 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04724  Glutamatergic synapse
Drug target
Dasolampanel: D10107
Dasolampanel etibutil: D10108
Dasolampanel etibutil tosylate: D10109
Riluzole: D00775<JP/US>
Tezampanel: D06656
Topiramate: D00537<JP/US>
Troriluzole (DG03011): D11414 D11415
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2897 (GRIK1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2897 (GRIK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2897 (GRIK1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2897 (GRIK1)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Other DBs
NCBI-GeneID: 2897
NCBI-ProteinID: NP_000821
OMIM: 138245
HGNC: 4579
Ensembl: ENSG00000171189
Pharos: P39086(Tclin)
UniProt: P39086
Structure
LinkDB
Position
21:complement(29536933..29939996)
AA seq 918 aa
MEHGTLLAQPGLWTRDTSWALLYFLCYILPQTAPQVLRIGGIFETVENEPVNVEELAFKF
AVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQ
SICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYAAISRAILDLVLYYNWKTVTVVYEDS
TGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEMKKGKEFYVIFDCSHETAAEIL
KQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSME
RLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRF
MNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGI
WNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCL
DLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREK
VIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFT
PYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTL
IIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKM
WAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYG
VGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDNKEASALGVENIGGIFI
VLAAGLVLSVFVAIGEFIYKSRKNNDIEQAFCFFYGLQCKQTHPTNSTSGTTLSTDLECG
KLIREERGIRKQSSVHTV
NT seq 2757 nt   +upstreamnt  +downstreamnt
atggagcacggcacactcctcgcccagcccgggctctggaccagggacaccagctgggca
ctcctctatttcctctgctatatcctccctcagaccgccccgcaagtactcaggatcgga
gggatttttgaaacagtggaaaatgagcctgttaatgttgaagaattagctttcaagttt
gcagtcaccagcattaacagaaaccgaaccctgatgcctaacaccacattaacctatgac
atccagagaattaacctttttgatagttttgaagcctcgcggagagcatgtgaccagctg
gctcttggtgtggctgctctctttggcccttcccatagctcctccgtcagtgctgtgcag
tctatttgcaatgctctcgaagttccacacatacagacccgctggaaacacccctcggtg
gacaacaaagatttgttttacatcaacctttacccagattatgcagctatcagcagggcg
atcctggatctggtcctctattacaactggaaaacagtgacagtggtgtatgaagacagc
acaggtctaattcgtctacaagagctcatcaaagctccctccagatataatattaaaatc
aaaatccgccagctgccctctgggaataaagatgccaagcctttactcaaggagatgaag
aaaggcaaggagttctatgtgatatttgattgttcacatgaaacagccgctgaaatcctt
aagcagattctgttcatgggcatgatgaccgagtactatcactactttttcacaaccctg
gacttatttgctttggatctggaactctataggtacagtggcgtaaacatgaccgggttt
cggctgcttaacattgacaaccctcacgtgtcatccatcattgagaagtggtccatggag
agactgcaggccccacccaggcccgagactggccttttggatggcatgatgacaactgaa
gcggctctgatgtacgatgctgtgtacatggtggccattgcctcgcaccgggcatcccag
ctgaccgtcagctccctgcagtgccatagacataagccatggcgcctcggacccagattt
atgaacctgatcaaagaggcccggtgggatggcttgactgggcatatcacctttaataaa
accaatggcttgaggaaggattttgatctggacattattagtctcaaagaggaaggaact
gaaaaggctgctggcgaagtgtctaaacacttgtataaagtgtggaagaagattgggatt
tggaattccaacagtgggcttaacatgacggacagcaacaaagacaagtccagcaatatc
actgattcattggccaacagaacactcattgtcaccaccattctggaagaaccctatgtt
atgtacaggaaatctgataagcctctatatggaaatgacagatttgaaggatattgccta
gacctgttgaaagaattgtcaaacatcctgggtttcatttatgatgttaaactagttccc
gatggcaaatatggggcccagaatgacaaaggggagtggaacgggatggttaaagaactc
atagatcacagggctgacctggcagtggctcctcttaccatcacctacgtgcgggagaaa
gtcattgacttctccaaacccttcatgaccctaggcatcagcattctctaccggaagccc
aatggtaccaatccaggcgttttctccttcctcaaccccctgtctccagatatttggatg
tatgtgctcttagcctgcttgggagtcagctgtgtactctttgtgattgcaaggtttaca
ccctacgagtggtataacccccacccatgcaaccctgactcagacgtggtggaaaacaat
tttactttactaaatagtttctggtttggagttggagctctcatgcagcaaggatcagag
ctgatgcccaaagctctatcgaccagaatagttggagggatatggtggtttttcacccta
atcatcatttcatcctacacggccaatctggctgccttcttgacagtagagagaatggaa
tcccccatagattcggcagatgatctggcaaagcaaaccaagatagaatatggggcggtt
agagatggatcaacaatgaccttcttcaagaaatcaaaaatctccacctatgagaagatg
tgggctttcatgagcagcaggcagcagaccgccctggtaagaaacagtgatgaggggatc
cagagagtgctcaccacagactacgcgctgctgatggagtccaccagcattgagtatgtg
acgcagagaaactgcaacctcactcagatcgggggcctcattgactccaaaggttacgga
gtgggaacacctattggttctccttaccgggataaaattactattgctattcttcaactc
caagaagaagggaagctgcatatgatgaaagagaagtggtggcgtgggaatggctgcccc
gaggaagacaacaaagaagccagtgccctgggagtggaaaatattggaggcatcttcatt
gttctggctgccggactggtcctttctgtatttgtagctattggagaattcatatacaaa
tcacggaagaataatgatattgaacaggctttttgtttcttttatggactgcaatgtaag
caaacccatccaaccaactccacttctggaactactttatctacggatttagaatgtggt
aaattaattcgagaggagagagggattcgaaaacagtcctcagttcatactgtgtaa

KEGG   Homo sapiens (human): 2898
Entry
2898              CDS       T01001                                 
Symbol
GRIK2, EAA4, GLR6, GLUK6, GLUR6, GluK2, MRT6, NEDLAS
Name
(RefSeq) glutamate ionotropic receptor kainate type subunit 2
  KO
K05202  glutamate receptor, ionotropic kainate 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04724  Glutamatergic synapse
Disease
H00768  Autosomal recessive intellectual developmental disorder
Drug target
Dasolampanel: D10107
Dasolampanel etibutil: D10108
Dasolampanel etibutil tosylate: D10109
Riluzole: D00775<JP/US>
Tezampanel: D06656
Topiramate: D00537<JP/US>
Troriluzole (DG03011): D11414 D11415
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2898 (GRIK2)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2898 (GRIK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2898 (GRIK2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2898 (GRIK2)
SSDB
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Other DBs
NCBI-GeneID: 2898
NCBI-ProteinID: NP_068775
OMIM: 138244
HGNC: 4580
Ensembl: ENSG00000164418
Pharos: Q13002(Tclin)
UniProt: Q13002 Q8IY40 A8K0H7
Structure
LinkDB
Position
6:101393708..102070083
AA seq 908 aa
MKIIFPILSNPVFRRTVKLLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFA
VNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQS
ICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDST
GLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILK
QALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFM
SLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGK
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEI
RLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKS
NEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI
AILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVG
EFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRR
LPGKETMA
NT seq 2727 nt   +upstreamnt  +downstreamnt
atgaagattattttcccgattctaagtaatccagtcttcaggcgcaccgttaaactcctg
ctctgtttactgtggattggatattctcaaggaaccacacatgtattaagatttggtggt
atttttgaatatgtggaatctggcccaatgggagctgaggaacttgcattcagatttgct
gtgaacacaattaacagaaacagaacattgctacccaatactacccttacctatgatacc
cagaagataaacctttatgatagttttgaagcatccaagaaagcctgtgatcagctgtct
cttggggtggctgccatcttcgggccttcacacagctcatcagcaaacgcagtgcagtcc
atctgcaatgctctgggagttccccacatacagacccgctggaagcaccaggtgtcagac
aacaaagattccttctatgtcagtctctacccagacttctcttcactcagccgtgccatt
ttagacctggtgcagtttttcaagtggaaaaccgtcacggttgtgtatgatgacagcact
ggtctcattcgtttgcaagagctcatcaaagctccatcaaggtataatcttcgactcaaa
attcgtcagttacctgctgatacaaaggatgcaaaacccttactaaaagaaatgaaaaga
ggcaaggagtttcatgtaatctttgattgtagccatgaaatggcagcaggcattttaaaa
caggcattagctatgggaatgatgacagaatactatcattatatctttaccactctggac
ctctttgctcttgatgttgagccctaccgatacagtggtgttaacatgacagggttcaga
atattaaatacagaaaatacccaagtctcctccatcattgaaaagtggtcgatggaacga
ttgcaggcacctccgaaacccgattcaggtttgctggatggatttatgacgactgatgct
gctctaatgtatgatgctgtgcatgtggtgtctgtggccgttcaacagtttccccagatg
acagtcagttccttgcagtgtaatcgacataaaccctggcgcttcgggacccgctttatg
agtctaattaaagaggcacattgggaaggcctcacaggcagaataactttcaacaaaacc
aatggcttgagaacagattttgatttggatgtgatcagtctgaaggaagaaggtctagaa
aagattggaacgtgggatccagccagtggcctgaatatgacagaaagtcaaaagggaaag
ccagcgaacatcacagattccttatccaatcgttctttgattgttaccaccattttggaa
gagccttatgtcctttttaagaagtctgacaaacctctctatggtaatgatcgatttgaa
ggctattgcattgatctcctcagagagttatctacaatccttggctttacatatgaaatt
agacttgtggaagatgggaaatatggagcccaggatgatgccaatggacaatggaatgga
atggttcgtgaactaattgatcataaagctgaccttgcagttgctccactggctattacc
tatgttcgagagaaggtcatcgacttttccaagccctttatgacacttggaataagtatt
ttgtaccgcaagcccaatggtacaaacccaggcgtcttctccttcctgaatcctctctcc
cctgatatctggatgtatattctgctggcttacttgggtgtcagttgtgtgctctttgtc
atagccaggtttagtccttatgagtggtataatccacacccttgcaaccctgactcagac
gtggtggaaaacaattttaccttgctaaatagtttctggtttggagttggagctctcatg
cagcaaggttctgagctcatgcccaaagcactgtccaccaggatagtgggaggcatttgg
tggtttttcacacttatcatcatttcttcgtatactgctaacttagccgcctttctgaca
gtggaacgcatggaatcccctattgactctgctgatgatttagctaaacaaaccaagata
gaatatggagcagtagaggatggtgcaaccatgacttttttcaagaaatcaaaaatctcc
acgtatgacaaaatgtgggcctttatgagtagcagaaggcagtcagtgctggtcaaaagt
aatgaagaaggaatccagcgagtcctcacctctgattatgctttcctaatggagtcaaca
accatcgagtttgttacccagcggaactgtaacctgacacagattggcggccttatagac
tctaaaggttatggcgttggcactcccatgggttctccatatcgagacaaaattaccata
gcaattcttcagctgcaagaggaaggcaaactgcatatgatgaaggagaaatggtggagg
ggcaatggttgcccagaagaggagagcaaagaggccagtgccctgggggttcagaatatt
ggtggcatcttcattgttctggcagccggcttggtgctttcagtttttgtggcagtggga
gaatttttatacaaatccaaaaaaaacgctcaattggaaaagaggtccttctgtagtgcc
atggtagaagaattgaggatgtccctgaagtgccagcgtcggttaaaacataagccacag
gccccagttattgtgaaaacagaagaagttatcaacatgcacacatttaacgacagaagg
ttgccaggtaaagaaaccatggcataa

DBGET integrated database retrieval system