KEGG   Homo sapiens (human): 116983
Entry
116983            CDS       T01001                                 
Symbol
ACAP3, CENTB5
Name
(RefSeq) ArfGAP with coiled-coil, ankyrin repeat and PH domains 3
  KO
K12489  Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116983 (ACAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116983 (ACAP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    116983 (ACAP3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    116983 (ACAP3)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    116983 (ACAP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   116983 (ACAP3)
SSDB
Motif
Pfam: BAR_3 ArfGap PH Ank_5 Ank_2 Ank_3 Ank_4 Ank BAR PH_11 Exonuc_VII_L PH_8
Other DBs
NCBI-GeneID: 116983
NCBI-ProteinID: NP_085152
HGNC: 16754
Ensembl: ENSG00000131584
Pharos: Q96P50(Tdark)
UniProt: Q96P50 Q8WTZ1
LinkDB
Position
1:complement(1292391..1307930)
AA seq 834 aa
MTVEFEECVKDSPRFRATIDEVETDVVEIEAKLDKLVKLCSGMVEAGKAYVSTSRLFVSG
VRDLSQQCQGDTVISECLQRFADSLQEVVNYHMILFDQAQRSVRQQLQSFVKEDVRKFKE
TKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGALTLTRKCFRHLALDYVLQINVLQA
KKKFEILDSMLSFMHAQSSFFQQGYSLLHQLDPYMKKLAAELDQLVIDSAVEKREMERKH
AAIQQRTLLQDFSYDESKVEFDVDAPSGVVMEGYLFKRASNAFKTWNRRWFSIQNSQLVY
QKKLKDALTVVVDDLRLCSVKPCEDIERRFCFEVLSPTKSCMLQADSEKLRQAWVQAVQA
SIASAYRESPDSCYSERLDRTASPSTSSIDSATDTRERGVKGESVLQRVQSVAGNSQCGD
CGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSAVN
QIYEAQCEGAGSRKPTASSSRQDKEAWIKDKYVEKKFLRKAPMAPALEAPRRWRVQKCLR
PHSSPRAPTARRKVRLEPVLPCVAALSSVGTLDRKFRRDSLFCPDELDSLFSYFDAGAAG
AGPRSLSSDSGLGGSSDGSSDVLAFGSGSVVDSVTEEEGAESEESSGEADGDTEAEAWGL
ADVRELHPGLLAHRAARARDLPALAAALAHGAEVNWADAEDEGKTPLVQAVLGGSLIVCE
FLLQNGADVNQRDSRGRAPLHHATLLGRTGQVCLFLKRGADQHALDQEQRDPLAIAVQAA
NADIVTLLRLARMAEEMREAEAAPGPPGALAGSPTELQFRRCIQEFISLHLEES
NT seq 2505 nt   +upstreamnt  +downstreamnt
atgaccgtggagttcgaggagtgcgtcaaggactccccgcgcttcagggcgaccattgac
gaggtggagacggacgtggtggagattgaggccaaactggacaagctggtgaagctgtgc
agtggcatggtggaagccggtaaggcctacgtcagcaccagcaggcttttcgtgagcggc
gtccgcgacctgtcccagcagtgccagggcgacaccgtcatctcggaatgtctgcagagg
ttcgctgacagcctacaggaggtggtgaactaccacatgatcctgtttgaccaggcccag
aggtccgtgcggcagcagctccagagctttgtcaaagaggatgtgcggaagttcaaggag
acaaagaagcagtttgacaaggtgcgggaggacctggagctgtccctggtgaggaacgcc
caggccccgaggcaccggccccacgaggtggaggaagccaccggggccctcaccctcacc
aggaagtgcttccgccacctggcactggactatgtgctccagatcaatgttctgcaggcc
aagaagaagtttgagatcctggactctatgctgtccttcatgcacgcccagtccagcttc
ttccagcagggctacagcctcctgcaccagctggacccctacatgaagaagctggcagcc
gagctggaccagctggtgatcgactctgcggtggaaaagcgtgagatggagcgaaagcac
gccgccatccagcagcggacgctgctgcaggacttctcctacgatgagtccaaagtggag
tttgacgtggacgcgcccagtggggtggtgatggagggctacctcttcaagagggccagc
aacgctttcaagacatggaaccggcgctggttctccattcagaacagccagctggtctac
cagaagaagctcaaggatgccctcaccgtggtggtggatgacctccgcctgtgctctgtg
aagccgtgtgaggacatcgagcggaggttctgcttcgaggtgctgtcacccaccaagagc
tgcatgctgcaggctgactccgagaagctgcggcaagcctgggtccaggctgtgcaggcc
agcatcgcctccgcctaccgcgagagccctgacagttgctatagcgagaggctggaccgc
acagcatccccgtccacgagcagcatcgactccgccaccgacactcgggagcgtggcgtg
aagggcgagagtgtgctgcagcgtgtgcagagtgtggccggcaacagccagtgcggcgac
tgcggccagccggacccccgctgggccagcatcaacctgggcgtgctgctctgcattgag
tgctccggcatccacaggagcctgggtgtccactgctccaaggtgcggtccctgacgctg
gactcgtgggagcctgagctgctaaagctgatgtgtgagcttggaaacagcgctgtgaat
cagatctatgaggcccagtgtgagggtgcaggcagcaggaaacccacagccagcagctcc
cggcaggacaaggaggcctggatcaaggacaaatacgtggaaaagaagtttctgcggaag
gcgcccatggcaccagccctggaggccccaagacgctggagggtgcagaagtgcctgcgg
ccccacagctctccccgcgctcccactgcccgccgcaaggtccggcttgagcccgttctg
ccctgtgtggccgctctgtcctcagtgggcaccctggatcgtaagttccgccgagactcc
ctcttctgtcccgacgagctggactcgctcttctcctacttcgacgcaggggccgcaggg
gctggccctcgcagtctgagtagcgacagtggccttgggggcagctcggatggcagctcg
gacgtcctggctttcggctcgggctctgtggtggacagcgtcactgaggaggagggtgca
gagtcggaggagtccagcggtgaggcagacggggacactgaggccgaggcctggggcctg
gcggacgtgcgcgagctgcacccggggctcttggcgcaccgcgcagcgcgtgcccgcgac
cttcctgcgctggcggcggcgctggcccacggggccgaggtcaactgggcggacgcggag
gatgagggcaagacgccgctggtgcaggccgtgctagggggctccttgatcgtctgtgag
ttcctgctgcaaaacggagcggacgtgaaccaaagagacagccggggccgggcgcccctg
caccacgccacgctgctgggccgcaccggccaggtttgcctgttcctgaagcggggcgcg
gaccagcacgccctggaccaagagcagcgggacccgttggccatcgcagtgcaggcggcc
aacgctgacatcgtgacactgctccgtctggcgcgcatggcggaggaaatgcgcgaggcc
gaggctgcccctggtcccccgggcgccctggcgggcagccccacggagctccagttccgc
aggtgtatccaggagttcatcagcctccacctggaagagagctag

KEGG   Homo sapiens (human): 116984
Entry
116984            CDS       T01001                                 
Symbol
ARAP2, CENTD1, PARX
Name
(RefSeq) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2
  KO
K18440  Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116984 (ARAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116984 (ARAP2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    116984 (ARAP2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    116984 (ARAP2)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    116984 (ARAP2)
SSDB
Motif
Pfam: PH RhoGAP ArfGap SAM_1 PH_6 SAM_2 PH_11 PH_3 RA PH_8 DNA_pol_phi
Other DBs
NCBI-GeneID: 116984
NCBI-ProteinID: NP_056045
OMIM: 606645
HGNC: 16924
Ensembl: ENSG00000047365
Pharos: Q8WZ64(Tbio)
UniProt: Q8WZ64 A7E2A5
Structure
LinkDB
Position
4:complement(36005404..36244784)
AA seq 1704 aa
MSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRI
LKQLQIILSKMQDIPIYANVHKTKKNDDPSKDYHVPSSDQNICIELSNSGSVQTSSPPQL
ETVRKNLEDSDASVERSQYPQSDDKLSPPKRDFPTAEEPHLNLGSLNDSLFGSDNIKIES
LITKKTVDHTVEEQQTEKVKLITENLSKLPNADSECLSFVGCSTSGTNSGNGTNGLLEGS
PPSPFFKFQGEMIVNDLYVPSSPILAPVRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGVS
GSYFRERRNVATSTEKSVAWQNSNEENSSSIFPYGETFLFQRLENSKKRSIKNEFLTQGE
ALKGEAATATNSFIIKSSIYDNRKEKISEDKVEDIWIPREDKNNFLIDTASESEYSTVEE
CFQSLRRKNSKASKSRTQKALILDSVNRHSYPLSSTSGNADSSAVSSQAISPYACFYGAS
AKKVKSGWLDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAISTVRVQGD
NKFEVVTTQRTFVFRVEKEEERNDWISILLNALKSQSLTSQSQAVVTPEKCGYLELRGYK
AKIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFT
AETEKEKQDWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVIC
KKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMD
SPVEKRKNFITQKYKEGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMC
ATGDPVHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGVLSQESSQSTFLCDFLY
QAPSAASKLSSEKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAIHKED
FYLNTGPIFIFEIYLPSERVFLFGAETSQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQ
LFYKDCHALDQWRKGWFAMDKSSLHFCLQMQEVQGDRMHLRRLQELTISTMVQNGEKLDV
LLLVEKGRTLYIHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVT
QYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTAVLKSFLSDIDDAL
LTKELYPYWISALDTQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMN
AHNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDT
QVSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVI
ENEELERPLHYKENVLEQVLRWSSLAEPGSAYLVVKRFLTADTIKHCSDRSTLGSIKEGI
LKIKEEPSKILSGNKFQDRYFVLRDGFLFLYKDVKSSKHDKMFSLSSMKFYRGVKKKMKP
PTSWGLTAYSEKHHWHLCCDSSRTQTEWMTSIFIAQHEYDIWPPAGKERKRSITKNPKIG
GLPLIPIQHEGNATLARKNIESARAELERLRLSEKCDKESVDSSLKERASMVAHCLEHKD
DKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVI
EELNVVLQRSRTLPKELQDEQILK
NT seq 5115 nt   +upstreamnt  +downstreamnt
atgtcctcagtcagtgaagtaaatgtggatataaaagatttcctaatgagcattaatttg
gagcagtatctcttacatttccatgagtctggttttactactgtgaaggactgtgcagca
ataaatgacagcctgctgcagaaaattggaatatcacctacaggtcaccgtaggaggata
cttaaacagttacagataatcttgtcaaaaatgcaagatattccaatatatgcaaatgtt
cataaaactaagaagaatgatgacccttcaaaggattaccatgttccatcttctgatcag
aatatctgcatagaactttccaattctggtagtgttcagacatctagcccaccgcagttg
gagactgttagaaaaaatcttgaagacagtgatgcaagtgtggaaagaagccagtatcct
caatcagatgataagctgtctcctcctaaacgcgacttccccactgcagaggaaccacac
ctgaatttgggttctttgaatgattctttatttggtagtgacaatattaaaatagaatca
ttgattacaaagaagactgtggatcacacagttgaagaacaacaaacagaaaaagttaaa
ttgatcacagaaaatctcagtaagctccctaatgcagactctgaatgcctttcttttgtt
ggctgttcaacatcaggaacaaattctggaaatggaacaaatggtttattagaaggatca
ccaccatccccattctttaagtttcaaggagaaatgattgtaaatgacttgtatgttcca
tcatcaccaatcctagcacctgtgagaagtcgtagcaagttggtttcaagaccatctcga
tcttttctgctaagacatcgacctgtaccagagattccagggtcaacaaaaggagtttct
gggagctatttccgtgaaagaagaaatgttgctacctcaactgaaaaatctgtggcatgg
caaaattcaaatgaggagaattcatcttccatctttccttatggagagacctttctcttc
cagagactagaaaattccaagaagcgatctataaagaatgaatttttgacccagggagaa
gcactcaaaggggaagcagctactgcaacaaactcttttatcatcaaatcaagcatatac
gataacagaaaggagaaaataagcgaggacaaggtggaagatatttggatacctcgagag
gacaaaaacaattttttgatagacactgcttctgaatcagaatactcaacagtagaagaa
tgctttcagagtttaagaagaaaaaattcaaaggcatctaaatctaggactcaaaaagcc
ttgattttggactccgttaataggcacagttatccgttaagctcaacaagtggaaatgct
gattcatcagccgtttcttcacaggcaatatctccctatgcctgcttttatggagcatct
gcaaagaaggttaaatcaggatggctggataaactctctcctcaaggaaaacgcatgttt
caaaagagatgggtgaaatttgatggccttagcatttcttactacaataatgagaaggag
atgtattcgaaaggaataattcccctttctgctatatcaacagtacgagttcaaggagac
aacaaatttgaagttgttacaacacaaagaacttttgtttttagagtagaaaaagaagag
gagagaaatgactggatcagcatactattaaatgcactgaaatcacaatcccttacctcg
cagtctcaagctgttgttacacctgagaaatgtggatatcttgaattgagaggctataag
gcaaaaatttttactgtgttaagtggaaacagtgtgtggctttgcaaaaacgaacaggat
tttaagagtggacttggtattaccataattcctatgaatgtagcaaatgtaaagcaagtg
gaccgaactgtgaaacaatcttttgaaataatcactccctacaggagtttcagctttaca
gccgagactgaaaaggagaaacaagactggattgaagctgtgcagcaatcaatagcagaa
actctctctgattatgaagtagctgagaagatttggttcaatgaatccaacaggagctgt
gcagattgtaaagccccagatcctgactgggcatccatcaatctctgtgttgtcatctgt
aagaagtgtgcaggacagcatagatctttaggaccaaaagattccaaggttagaagtcta
aaaatggatgctagcatttggagcaatgaactcatcgagctttttattgtcattggaaac
aaaagagcaaatgacttttgggctggtaatcttcaaaaggatgaagaattacatatggac
tcaccagtagaaaagagaaaaaactttattactcagaaatataaagaaggaaaattcaga
aaaactcttttggcatctctcaccaaagaagaattaaataaggctctatgtgctgctgta
gtgaaaccggatgttctagaaacaatggctttgctgttcagtggagcagatgtcatgtgt
gccaccggagaccccgtgcatagcaccccctatctgctagccaagaaagctgggcaaagt
ctgcaaatggaatttctctaccataacaaattctcagatttccctcaacatgatattcat
tccgagggtgtattaagtcaagagtcttcccagtccacattcctctgtgactttttatat
caagctccttctgctgcttctaaactctcttcagagaaaaaactgcttgaagagacaaat
aaaaaatggtgtgttttggaaggaggcttcttgagttactatgaaaatgataagtctacc
acacctaatggcaccattaatatcaatgaagttatctgcctggctatacacaaagaggac
ttctatttaaatactgggcccatctttatctttgagatctacttaccctccgaacgtgtg
tttttatttggagctgaaacatctcaagctcaaagaaaatggacagaggcaatagccaag
cattttgttcccttatttgctgaaaacttaacagaagctgactatgatttgattggtcaa
ctcttctacaaagactgccatgccctggatcagtggagaaaaggctggtttgctatggac
aaatccagcttgcatttttgccttcaaatgcaagaagttcagggagatagaatgcactta
agaagactgcaagagctaacaatcagcacaatggttcaaaatggggaaaaactggatgtt
ttactcttggtagaaaaagggagaacattatacatccatgggcataccaagttggatttc
acagtctggcatactgcaattgaaaaagcagcaggtacagatggtaatgctttacaagat
cagcagctcagcaaaaatgacgttcccattatagtgaacagctgtatagcatttgttaca
cagtatggtttaggatgcaaatatatctatcaaaagaatggtgatcctttgcatataagt
gaactcctggagagtttcaaaaaggatgcaagaagctttaaattgagggctggaaaacat
cagcttgaagatgtgacggctgtgttgaaaagttttctctctgacattgatgatgcactg
cttactaaggagctctacccatattggatctctgctttagatacgcaagatgacaaggaa
agaattaaaaaatatggagcatttatacgttctcttccaggggtcaaccgagcaacacta
gcagctatcattgaacacctgtatagggttcagaaatgctcagaaatcaatcacatgaat
gcccataatttggccttggtcttttcatcctgtttgtttcaaacgaagggacaaactagt
gaagaagtgaatgtaattgaggacctaattaataattatgtagaaatatttgaggttaaa
gaagatcaagtcaaacaaatggacatagaaaatagctttattaccaagtggaaagacacc
caagtttcccaggctggagatttgttaattgaagtatatgtagaaaggaaggaacccgac
tgtagtattataattcggatatctcctgtgatggaagcagaagaattaactaatgatata
ttagcgataaaaaatattattcctacaaaaggtgatatttgggccacatttgaagtcatt
gaaaatgaagagctagagcgtcctcttcactacaaggaaaatgtactggagcaggtgctt
cggtggagttcattagctgaacctggctctgcttacctggtggtgaagagattcttaacc
gctgacacaattaaacactgcagtgaccggagtacactgggaagcatcaaagaaggaatc
ttgaaaatcaaagaagaaccatccaaaatactatctggaaataagtttcaagaccggtat
tttgttttacgagatgggtttctctttctttacaaggatgtgaagagtagtaaacatgac
aagatgttttctctcagttccatgaagttttatcgtggagtgaaaaagaaaatgaagcct
ccaacaagctggggattgaccgcatattctgagaaacatcactggcacctgtgttgtgat
agttcacgaactcagacggagtggatgaccagtatctttattgcccagcatgaatatgat
atatggccaccagctggaaaggaacgaaaacgttcaataaccaaaaatcccaaaattgga
ggtttgcctctgattcctatacagcatgaggggaatgcaaccttggcccggaaaaatatt
gagagtgcaagagcagaacttgaaaggctgcggctcagtgaaaagtgtgataaagagtcc
gtggactctagcttaaaggagagagcttccatggtggcccactgcctggagcacaaggac
gataaacttcgaaatcgaccccgaaaacatcggagtttcaactgcctggaggacacagag
cctgaagccccacttgggcaaccaaaaggccataaaggcctaaagacattgaggaagact
gaggacaggaatagcaaagctactttggactctgatcataagttaccatcaagggtaatt
gaagaacttaatgtggttctacaacggtcaagaacccttccaaaagaattacaggatgag
cagattttgaagtag

KEGG   Homo sapiens (human): 116985
Entry
116985            CDS       T01001                                 
Symbol
ARAP1, CENTD2, cnt-d2
Name
(RefSeq) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1
  KO
K18439  Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116985 (ARAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116985 (ARAP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    116985 (ARAP1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    116985 (ARAP1)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    116985 (ARAP1)
SSDB
Motif
Pfam: PH RhoGAP ArfGap RA PH_11 SAM_1 SAM_2 PH_8 PH_6 PH_2 PH_13 Thioredoxin_6
Other DBs
NCBI-GeneID: 116985
NCBI-ProteinID: NP_001035207
OMIM: 606646
HGNC: 16925
Ensembl: ENSG00000186635
Pharos: Q96P48(Tbio)
UniProt: Q96P48
Structure
LinkDB
Position
11:complement(72685069..72752408)
AA seq 1450 aa
MAEAGDAALSVAEWLRALHLEQYTGLFEQHGLVWATECQGLSDTRLMDMGMLLPGHRRRI
LAGLLRAHTSPAPAPRPTPRPVPMKRHIFRSPPVPATPPEPLPTTTEDEGLPAAPPIPPR
RSCLPPTCFTTPSTAAPDPVLPPLPAKRHLAELSVPPVPPRTGPPRLLVSLPTKEEESLL
PSLSSPPQPQSEEPLSTLPQGPPQPPSPPPCPPEIPPKPVRLFPEFDDSDYDEVPEEGPG
APARVMTKKEEPPPSRVPRAVRVASLLSEGEELSGDDQGDEEEDDHAYEGVPNGGWHTSS
LSLSLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYF
DSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERKEWMQALQQAMAE
QRARARLSSAYLLGVPGSEQPDRAGSLELRGFKNKLYVAVVGDKVQLYKNLEEYHLGIGI
TFIDMSVGNVKEVDRRSFDLTTPYRIFSFSADSELEKEQWLEAMQGAIAEALSTSEVAER
IWAAAPNRFCADCGAPQPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTET
LIELFLQLGNGAGNRFWAANVPPSEALQPSSSPSTRRCHLEAKYREGKYRRYHPLFGNQE
ELDKALCAAVTTTDLAETQALLGCGAGINCFSGDPEAPTPLALAEQAGQTLQMEFLRNNR
TTEVPRLDSMKPLEKHYSVVLPTVSHSGFLYKTASAGKLLQDRRAREEFSRRWCVLGDGV
LSYFENERAVTPNGEIRASEIVCLAVPPPDTHGFEHTFEVYTEGERLYLFGLESAEQAHE
WVKCIAKAFVPPLAEDLLARDFERLGRLPYKAGLSLQRAQEGWFSLSGSELRAVFPEGPC
EEPLQLRKLQELSIQGDSENQVLVLVERRRTLYIQGERRLDFMGWLGAIQKAAASMGDTL
SEQQLGDSDIPVIVYRCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVHLKEG
EQHVDDVSSALKRFLRDLPDGLFTRAQRLTWLEASEIEDEEEKVSRYRELLVRLPPVNRA
TVKALISHLYCVQCFSDTNQMNVHNLAIVFGPTLFQTDGQDYKAGRVVEDLINHYVVVFS
VDEEELRKQREEITAIVKMRVAGTASGTQHAGDFICTVYLEEKKAETEQHIKVPASMTAE
ELTLEILDRRNVGIREKDYWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVVKKHQ
AMEAMLLYLASRVGDTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRLYKEVRSQ
RPWSGAPETSHRPEKEWPIKSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDT
QMELREWFATFLFVQHDGLVWPSEPSRVSRAVPEVRLGSVSLIPLRGSENEMRRSVAAFT
ADPLSLLRNV
NT seq 4353 nt   +upstreamnt  +downstreamnt
atggcagaggctggggatgctgcgctatcggtggccgagtggctgcgggcattgcacctg
gagcagtacacggggctctttgagcagcatggcctggtgtgggccactgagtgccaaggc
ctcagcgacacccgcctgatggacatgggcatgctactccctggtcaccgccgccgcatc
ctggctggcctgctccgtgcccatacctcaccggcccctgcaccccgccccaccccacgg
cctgtgcccatgaagcgccacatcttccgctcaccacctgtgcctgccactccacccgag
ccgctgcccaccactacagaggatgaggggctccccgctgccccacccatcccgccccgg
aggagctgccttccgcccacctgcttcaccaccccatccacagctgccccagaccctgtg
ctgcccccgctgcctgctaagcggcatttggcagagctgagcgttccacccgtgccgccc
cgcaccggacccccccgcctgctggtgagcctgcccactaaggaggaggagtcattgctg
ccatcattatcatcccctccccagccacagtctgaggagcccctgtccaccctcccccag
gggcctccccagcctccctctccacctccctgccccccggagatacctccaaagccggta
cgcctgttcccagagttcgatgactctgactacgatgaggtcccagaggaggggccgggg
gccccagccagagtgatgaccaagaaggaggagcccccaccgagccgagtcccacgggcc
gtgcgcgtggccagtctgctgagcgagggagaggaactgtctggggacgaccaaggggat
gaggaagaggatgaccacgcctatgagggcgtccccaatggcggatggcataccagcagc
ctgagcttgtccttgcccagcacaatagctgcgccacaccccatggacgggccgcctggg
ggctccacccccgtcacaccagtcatcaaggctggctggctggacaagaacccaccgcag
ggatcttacatctatcagaaacgatgggtgagactggatactgatcacctgcgatacttt
gacagtaacaaggacgcttactctaagcgctttatctctgtggcctgcatctcccacgtg
gctgccatcggggaccagaagtttgaagtgatcacaaacaaccgaacctttgccttccgg
gcagagagtgatgtggagcggaaggagtggatgcaggccctgcagcaggccatggctgag
cagcgtgcccgggcccggctctctagcgcttatctgctgggagttccaggctcagagcag
cctgaccgcgctggcagcctggagcttcgtggcttcaagaataagctgtacgtggccgtg
gtcggggacaaagtgcagctctacaagaatctagaggagtaccacctgggcattggcatc
accttcatcgacatgagcgtgggcaacgtgaaggaagtggaccggcgcagcttcgacctc
accacgccctaccgcatcttcagcttctctgctgactcagagctagagaaggagcagtgg
ttggaggccatgcagggagccatcgctgaggccctgtctacctcggaggtggccgagcgc
atctgggctgcagcccccaacaggttctgtgctgactgcggggctcctcagcctgactgg
gcctccatcaacctctgtgttgttatctgcaagcgctgtgcaggggagcaccgtggcctg
ggcgctggcgtctccaaggtgcggagcctgaagatggacaggaaggtgtggacagaaaca
cttatcgagctcttcttacagctggggaatggcgctgggaaccgcttctgggcagccaac
gtgccccccagtgaggccctgcagcccagcagcagccccagcacccggcggtgccacctg
gaggccaagtaccgtgagggcaagtaccgccgctaccacccgctctttggcaaccaggag
gagctggacaaggccctgtgtgctgcagtcaccaccacagacctggctgagacccaggcg
ctcctgggctgtggggctgggatcaactgcttctcgggggaccctgaggcccccacgccc
ctggctcttgcagagcaggcggggcagacgctgcagatggaattccttcggaacaaccgg
accacagaggtgcctcggctggactcgatgaagcccctggaaaagcactactcagttgtc
ctgccgaccgtgagccacagtggcttcctctacaagactgcctctgccggcaagctgcta
caggaccgccgggcccgggaagagttcagccggcgctggtgtgtccttggtgacggggtc
ctgagctactttgagaatgagcgggcagtgacccccaatggagagattcgggccagcgag
attgtgtgcctggcagtgccccctcctgacacccatggctttgagcacacctttgaggtg
tacacggagggagaacggctgtacctgtttgggctggagagtgcggagcaggctcatgag
tgggtcaagtgtattgctaaggcattcgtgcctcccctagccgaggatctgctggcccgg
gattttgagcggctgggacgcctaccctacaaagctggcctgagcctacagcgggcccag
gagggctggttctctctcagtggctcggagctccgtgctgtcttcccggaggggccctgc
gaagagccgctgcaactacggaaactgcaggagctttccatccagggggacagtgagaac
caggtgctggtgctggtggagcgaaggaggacactgtacatacagggcgagcggcggctg
gacttcatgggttggctgggggccatccagaaagcagccgccagcatgggggacacgctg
tcggagcagcagcttggggactcggatatcccggtgatcgtgtaccgctgtgtggactac
atcacgcagtgcggcctgacctccgagggcatctaccgcaagtgtgggcagacatcgaag
acacagcggctgctggagagcctgcggcaggatgcgcgctctgtgcacctcaaggagggc
gagcagcacgtggatgatgtttcctcggcgctcaagcgcttcctgcgcgacctgcctgat
gggctcttcactcgcgcccagcgcctaacctggctggaggcctcagagattgaggacgag
gaggagaaggtctccaggtaccgagagctgctggtgcggctgccccctgtcaaccgggcc
acagtgaaggcccttatcagccacctgtactgtgttcagtgcttctcagacacgaaccag
atgaacgtgcacaacctggcaattgtgtttgggcccacgctcttccagacagatgggcag
gactacaaggctggccgtgtggtggaagacctcattaaccactatgtggtggtgtttagt
gtggatgaggaagagctcaggaagcagcgggaggagatcactgccattgtgaagatgcgc
gtggctggcactgccagtgggacccagcatgccggtgacttcatctgcacagtgtatctg
gaagagaagaaggcagagactgagcagcatatcaaggtcccagcatccatgactgctgag
gagctcaccctggagatcctggatcgccggaacgtgggcatcagggagaaggactattgg
acctgctttgaggtcaacgagagggaggaggcagagcgccccctgcactttgcggagaag
gtgctgcccatcctgcacgggctgggcacggacagccacctggtggtgaagaagcaccag
gccatggaggccatgctgctgtacctggccagccgtgtcggtgacaccaagcatggcatg
atgaagttccgtgaggaccgcagcctcctgggcctgggcctgccctcaggtggcttccac
gatcgctacttcatcctcaacagcagctgcttgcggctctacaaggaggtccggagccag
aggccgtggagcggggcccctgagaccagtcaccggcctgagaaggagtggcctattaag
agtctcaaagtctacctgggagtgaagaagaaactcaggccacccacctgctggggcttc
acagtggtgcatgagacagagaaacatgagaagcagcagtggtacctctgctgtgacaca
cagatggagctccgggagtggttcgctacctttctgtttgtgcagcatgacggcctggtg
tggccctcagagccctcacgcgtgtcccgggcagtgcctgaggtccggctgggtagtgtg
tcactgatcccccttcgaggtagtgaaaatgaaatgcgccggagtgtggctgccttcacc
gcggaccctctgtctcttctgcgcaacgtctga

KEGG   Homo sapiens (human): 116986
Entry
116986            CDS       T01001                                 
Symbol
AGAP2, CENTG1, GGAP2, PIKE
Name
(RefSeq) ArfGAP with GTPase domain, ankyrin repeat and PH domain 2
  KO
K17848  Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    116986 (AGAP2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116986 (AGAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116986 (AGAP2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    116986 (AGAP2)
SSDB
Motif
Pfam: ArfGap Ras PH Ank_2 Ank Ank_5 Ank_4 PH_6 Roc SpoIVA_ATPase MLVIN_C
Other DBs
NCBI-GeneID: 116986
NCBI-ProteinID: NP_001116244
OMIM: 605476
HGNC: 16921
Ensembl: ENSG00000135439
Pharos: Q99490(Tbio)
UniProt: Q99490 F8VVT9
Structure
LinkDB
Position
12:complement(57723761..57742161)
AA seq 1192 aa
MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAAGAAGARGSETGDPGSPRGAEE
PGKKRHERLFHRQDALWISTSSAGTGGAEPPALSPAPASPARPVSPAPGRRLSLWAVPPG
PPLSGGLSPDPKPGGAPTSSRRPLLSSPSWGGPEPEGRAGGGIPGSSSPHPGTGSRRLKV
APPPPAPKPCKTVTTSGAKAGGGKGAGSRLSWPESEGKPRVKGSKSSAGTGASVSAAATA
AAAGGGGSTASTSGGVGAGAGARGKLSPRKGKSKTLDNSDLHPGPPAGSPPPLTLPPTPS
PATAVTAASAQPPGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISGIFTKSTGGPP
GSGPLPGPPSLSSGSGSRELLGAELRASPKAVINSQEWTLSRSIPELRLGVLGDARSGKS
SLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFS
LEDENSFQAVSRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCADMK
RCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQAS
NGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFANRRGSDSEK
RSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHS
THGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGLEATTPMPSPSP
SPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTT
PSKTEGSAGQAEAKRKMWKLKSFGSLRNIYKAEENFEFLIVSSTGQTWHFEAASFEERDA
WVQAIESQILASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLN
LGALICIECSGIHRNLGTHLSRVRSLDLDDWPRELTLVLTAIGNDTANRVWESDTRGRAK
PSRDSSREERESWIRAKYEQLLFLAPLSTSEEPLGRQLWAAVQAQDVATVLLLLAHARHG
PLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQGRTALFYARQAGSQLCA
DILLQHGCPGEGGSAATTPSAATTPSITATPSPRRRSSAASVGRADAPVALV
NT seq 3579 nt   +upstreamnt  +downstreamnt
atgagccggggcgcgggcgcgcttcagcgccggacaacgacctacctcatctcgctgacc
ctggttaagctcgagtcggtgcctccgccgccgccttctccgtctgcggccgcggccggc
gccgccggtgccagaggctccgagactggggatcctggcagcccccgaggcgcggaggag
ccgggcaagaagcggcacgaacgtctcttccaccggcaggatgcgctgtggatcagcacg
agcagcgcgggcaccgggggcgcggagcccccagccctgtccccggctccggccagtccg
gcccgcccagtctcccccgctcccggccgccgcctctccctctgggccgtccctccggga
cccccgctctccgggggactgagccccgaccccaagcctgggggcgcccccacctcctcc
cggcgccccctgctcagcagcccgagctggggcggcccggagcccgaaggccgggcgggc
ggcggcatccctggctcatcctctccgcaccctggcaccggcagccggaggctcaaggtg
gcgcctcctccgccggctcccaagccttgcaagaccgtgaccacgagtggagccaaagcc
ggcgggggcaagggcgcgggtagccgcctgtcatggcccgaaagcgagggcaagcccagg
gtcaaggggtcaaagagcagcgccgggactggagcttcggtctctgccgccgccaccgcc
gccgccgccgggggagggggctctacagcttcgacctctggtggggtcggggctggggct
ggagcccgagggaagttgtcccctcggaaaggcaagagtaagaccttggacaacagtgac
ttgcatccgggaccgcctgccggctctcctcctccgctaaccctcccaccaactccgagt
ccagccactgctgtcaccgctgcttccgcgcagccccccgggcctgcacctccaatcact
ctggagcctccagctccggggctgaaacggggccgggaggggggccgagcatccactcgt
gaccgcaagatgctcaagtttatcagcggcatcttcaccaagagcacaggagggcctcct
ggctccgggccccttcccggaccccccagcctgtcttctggcagcgggtccagggagctg
ctgggcgccgagctccgcgcttcccctaaggctgtgatcaatagccaggaatggactttg
agccgctccattcctgaactgcgcctgggtgtgctgggcgatgccaggagtgggaagtca
tcgctcatccaccgattcctgactggctcataccaggtgctggagaagacagagagtgag
cagtacaagaaagaaatgttggtggatggacagacacatctggtgctaatccgagaggaa
gctggggcacctgatgccaagttctcaggctgggcagatgctgtgatcttcgtcttcagc
ctggaggatgagaacagtttccaggctgtgagccgtctccatgggcagctgagttccctt
cgcggggagggacgaggaggcctggccttggcactggtggggacacaagacaggatcagt
gcttcctcccctcgggtggtgggagatgctcgtgccagagctctgtgcgcggacatgaaa
cgctgcagctactatgagacttgtgcaacctatgggctcaatgtggatcgggtcttccag
gaggtggcccagaaggtggtgaccttgcgcaagcagcaacagcttctggctgcctgcaag
tccctgcccagctccccaagccactcagctgcatccactccggtagctggccaggctagt
aacgggggccacactagcgactactcttcttccctcccgtcctcaccgaatgttggtcac
cgggagctccgagccgaggcagctgcagtggctggattgagcaccccagggtccctgcac
cgggcagccaagcgcaggaccagcctttttgcgaatcgtcggggtagtgactccgagaaa
cgaagcttggatagtcggggagagacaacagggagtgggcgagccatccccatcaaacag
agcttcctactaaaacgaagtggcaattccttgaacaaagaatggaagaagaaatatgta
accctgtccagtaatggctttctactctaccaccccagtattaacgattacatccacagt
acccacggcaaggagatggacttgctgcgaacaacagtcaaagtcccgggcaagcggccc
ccgagggccatctctgcctttggcccctcagccagcattaacgggctcgtcaaggacatg
agcactgtccagatgggtgaaggcctggaagccactactcccatgccaagccctagcccc
agccccagttccctgcagccaccaccagatcagacatccaaacacctgctgaagccagac
cggaatttggcccgagccctcagcacggactgtaccccatctggagacctgagccccctg
agtcgggaaccccctccttctcccatggtgaagaagcagaggaggaaaaaattgacaaca
ccatccaagactgaaggctcggctgggcaggctgaagccaagcgcaaaatgtggaaacta
aaatcctttggtagtttaagaaatatttataaagcagaggaaaactttgagttcctgatc
gtgtccagcacgggtcagacgtggcactttgaggcagccagttttgaggagcgggatgcc
tgggtccaggccatcgagagtcagatcctagccagtctgcaatgctgtgagagcagcaag
gtcaagctgcgcacagacagccaaagcgaggccgtggccatccaggcgatccggaacgcc
aaggggaattcaatctgcgtggactgcggggcccccaaccccacgtgggccagcttgaac
ctgggcgccctcatctgcatcgagtgttctggcatccaccgcaacctgggcacacacctg
tcccgcgttcgctcgctggacttggacgactggccacgggagctgaccctggtgctgacg
gctattggcaacgacacggccaaccgcgtgtgggaaagcgacacgcgaggccgtgccaag
ccctcgcgggactcttcgcgggaggagcgcgagtcgtggattcgcgccaagtacgagcag
ctactgttcctggcgccgctgagcacctcggaggagccgctgggccgccagctgtgggcc
gccgtgcaggcccaggacgtggctaccgttctcctgcttttggcccatgcgcgacacggg
ccgctcgacaccagcgtagaggacccacagctgcgctccccactccacctggcggccgag
ctcgcccacgtcgtcatcacgcaactgctgctgtggtacggcgcggacgtggcggcccgt
gacgcccagggccgcacggcgctgttctacgcccgccaggctggaagccagctgtgcgcc
gacatccttctccagcacggctgcccgggtgagggcggcagcgcggccaccacgcccagc
gcggccaccacgcccagcatcaccgccacgcccagcccccgccgccggagcagcgccgct
agcgtgggccgcgccgacgccccggttgcgctggtatag

KEGG   Homo sapiens (human): 116987
Entry
116987            CDS       T01001                                 
Symbol
AGAP1, AGAP-1, CENTG2, GGAP1, cnt-g2
Name
(RefSeq) ArfGAP with GTPase domain, ankyrin repeat and PH domain 1
  KO
K12491  Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1/3/4/5/6/9/11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116987 (AGAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116987 (AGAP1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    116987 (AGAP1)
SSDB
Motif
Pfam: ArfGap Ras PH Ank_2 Ank Ank_5 Ank_4 Ank_3 Roc PH_6 MAGI_u1 PH_4
Other DBs
NCBI-GeneID: 116987
NCBI-ProteinID: NP_001032208
OMIM: 608651
HGNC: 16922
Ensembl: ENSG00000157985
Pharos: Q9UPQ3(Tbio)
UniProt: Q9UPQ3 B2RZG9
Structure
LinkDB
Position
2:235494043..236131793
AA seq 857 aa
MNYQQQLANSAAIRAEIQRFESVHPNIYSIYELLERVEEPVLQNQIREHVIAIEDAFVNS
QEWTLSRSVPELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLL
LIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYSRMANYRNTSEIPLVLVGTQD
AISSANPRVIDDARARKLSNDLKRCTYYETCATYGLNVERVFQDVAQKIVATRKKQQLSI
GPCKSLPNSPSHSSVCSAQVSAVHISQTSNGGGSLSDYSSSVPSTPSTSQKELRIDVPPT
ANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSIGSGRAIPIKQGMLLKRSGKS
LNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPI
SSPKTNGLSKDMSSLHISPNSGNVTSASGSQMASGISLVSFNSRPDGMHQRSYSVSSADQ
WSEATVIANSAISSDTGLGDSVCSSPSISSTTSPKLDPPPSPHANRKKHRRKKSTSNFKA
DGLSGTAEEQEENFEFIIVSLTGQTWHFEATTYEERDAWVQAIESQILASLQSCESSKNK
SRLTSQSEAMALQSIRNMRGNSHCVDCETQNPNWASLNLGALMCIECSGIHRNLGTHLSR
VRSLDLDDWPVELIKVMSSIGNELANSVWEESSQGRTKPSVDSTREEKERWIRAKYEQKL
FLAPLPCTELSLGQHLLRATADEDLRTAILLLAHGSRDEVNETCGEGDGRTALHLACRKG
NVVLAQLLIWYGVDVTARDAHGNTALAYARQASSQECIDVLLQYGCPDERFVLMATPNLS
RRNNNRNNSSGRVPTII
NT seq 2574 nt   +upstreamnt  +downstreamnt
atgaactaccagcagcagctggccaactcggctgccatccgggccgagatccagcgcttc
gagtcggtccaccccaacatctactccatctacgagctgctggagcgcgtggaggagccg
gtgctgcagaaccagatccgggagcacgtcatcgccatcgaagatgccttcgtgaacagc
caggaatggacgctgagtcgatctgtcccggagctcaaagtgggaattgtgggtaacttg
gccagcggcaagtctgccctggtgcaccggtacctgacgggcacatatgtccaggaggag
tctccggaaggtggcaggttcaagaaagagattgtcgttgatggacagagctatctgctg
ctgatcagagatgaagggggccccccggaggcgcagtttgccatgtgggtggacgctgtt
atatttgtcttcagcttggaggatgaaataagtttccagaccgtttaccactactacagt
cgaatggccaactatcggaacacgagcgagattcctctggttctggtgggaacccaggat
gccataagttctgctaacccgagggtcatcgatgacgccagggcgaggaagctctccaac
gacctgaaacggtgcacgtactacgagacgtgtgctacatacgggctgaatgtggagagg
gtcttccaggacgttgcccagaagattgttgccacaaggaagaagcagcagctgtccata
ggaccctgcaagtcgctacctaattctcccagccattcctccgtctgttccgcgcaggtg
tctgccgtgcacatcagccagacaagtaatggaggtgggagtttaagcgactattcctcc
tccgttccatcgactcccagcaccagccagaaggaacttcggatcgatgttcctcccact
gccaacacgcccacgcccgttcgcaagcagtctaagcgccggtccaacctgttcacctct
cggaaagggagcgacccagacaaagagaagaaaggcctggagagtcgtgcggacagcatt
gggagcggccgagccatcccaattaaacagggcatgctgttgaagcgaagtggcaaatcg
ttgaataaagagtggaaaaagaaatatgtcaccctgtgtgacaatggcgtgctgacctat
catcccagtttacatgattacatgcagaatgttcatggtaaggagattgaccttctgaga
accactgtgaaagtcccagggaagaggccaccccgagccacgtcagcctgcgcacccatc
tccagccctaaaaccaatggcctatccaaggacatgagcagtttacacatctcacccaat
tcagggaatgtcactagtgcatctgggtctcagatggcaagcggcatcagcctggtctcc
ttcaacagccgacccgacggcatgcaccagcgctcctactcagtctccagtgccgaccag
tggagtgaggctacggtcattgcaaactcggccatcagcagtgacacagggctgggtgac
tccgtatgctccagccccagtatctccagcaccaccagccccaagctcgacccgcccccc
tcccctcacgccaacagaaagaagcaccgaaggaagaaaagcactagcaacttcaaagcc
gacggcctgtccggcactgctgaagaacaagaagaaaattttgagtttatcattgtgtcc
ctcactggccaaacatggcactttgaagccacgacgtatgaggagcgggacgcctgggtc
caagccatcgagagccagatcctggccagcctgcagtcgtgcgagagcagcaagaacaag
tcccggctgacgagccagagcgaggccatggccctgcagtcgatccggaacatgcgcggg
aactcccactgtgtggactgcgagacccagaatcccaactgggccagtttgaacttggga
gccctcatgtgcatcgaatgctcagggatccaccggaatcttggcacccacctttcccga
gtccgatctctggacctggatgactggccagtcgagctcatcaaggtgatgtcatccatc
gggaacgagctagccaacagcgtctgggaagagagcagccaggggcggacgaaaccatcg
gtagactccacaagggaagagaaggaacggtggatccgtgccaagtacgagcagaagctc
ttcctggccccgctgccctgcacggagctgtccctgggccagcacctgctgcgggccacc
gccgacgaggacctgcggacggccatcctgctgctggcacacggctcccgggacgaggtg
aacgagacctgcggggagggagacggccgcacggcgctgcatctggcctgccgcaagggg
aatgtggtcctggcgcagctcctgatctggtacggagtggacgtcacggcccgagatgcc
cacgggaacacagctctggcctacgcccggcaggcctccagccaggagtgcatcgacgtg
ctgctgcagtacggctgccccgacgagcgcttcgtgctcatggccacccctaacctgtcc
aggagaaacaataaccggaacaacagcagtgggagggtgcccaccatcatctga

KEGG   Homo sapiens (human): 116988
Entry
116988            CDS       T01001                                 
Symbol
AGAP3, AGAP-3, CENTG3, CRAG, MRIP-1, cnt-g3
Name
(RefSeq) ArfGAP with GTPase domain, ankyrin repeat and PH domain 3
  KO
K12491  Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1/3/4/5/6/9/11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    116988 (AGAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    116988 (AGAP3)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    116988 (AGAP3)
SSDB
Motif
Pfam: ArfGap Ras PH Ank_2 Ank_4 Ank Ank_5 Roc PH_6 Imm30
Other DBs
NCBI-GeneID: 116988
NCBI-ProteinID: NP_114152
OMIM: 616813
HGNC: 16923
Ensembl: ENSG00000133612
Pharos: Q96P47(Tdark)
UniProt: Q96P47 Q86XV5
Structure
LinkDB
Position
7:151085867..151144434
AA seq 911 aa
MNFQAGGGQSPQQQQSLAAPGGGGAAAQQLVCGGQFGGAGPGAGGGGGPSQQLAGGPPQQ
FALSNSAAIRAEIQRFESVHPNIYAIYDLIERIEDLALQNQIREHVISIEDSFVNSQEWT
LSRSVPELKVGIVGNLSSGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRD
EGGPPELQFAAWVDAVVFVFSLEDEISFQTVYNYFLRLCSFRNASEVPMVLVGTQDAISA
ANPRVIDDSRARKLSTDLKRCTYYETCATYGLNVERVFQDVAQKVVALRKKQQLAIGPCK
SLPNSPSHSAVSAASIPAVHINQATNGGGSAFSDYSSSVPSTPSISQRELRIETIAASST
PTPIRKQSKRRSNIFTSRKGADLDREKKAAECKVDSIGSGRAIPIKQGILLKRSGKSLNK
EWKKKYVTLCDNGLLTYHPSLHDYMQNIHGKEIDLLRTTVKVPGKRLPRATPATAPGTSP
RANGLSVERSNTQLGGGTGAPHSASSASLHSERPLSSSAWAGPRPEGLHQRSCSVSSADQ
WSEATTSLPPGMQHPASGPAEVLSSSPKLDPPPSPHSNRKKHRRKKSTGTPRPDGPSSAT
EEAEESFEFVVVSLTGQTWHFEASTAEERELWVQSVQAQILASLQGCRSAKDKTRLGNQN
AALAVQAVRTVRGNSFCIDCDAPNPDWASLNLGALMCIECSGIHRHLGAHLSRVRSLDLD
DWPPELLAVMTAMGNALANSVWEGALGGYSKPGPDACREEKERWIRAKYEQKLFLAPLPS
SDVPLGQQLLRAVVEDDLRLLVMLLAHGSKEEVNETYGDGDGRTALHLSSAMANVVFTQL
LIWYGVDVRSRDARGLTPLAYARRAGSQECADILIQHGCPGEGCGLAPTPNREPANGTNP
SAELHRSPSLL
NT seq 2736 nt   +upstreamnt  +downstreamnt
atgaacttccaggcgggcggggggcagagcccgcagcagcagcagagcctggcggctccg
gggggcggcggcgctgccgcgcagcagctcgtctgcggcgggcagttcggcggcgcgggg
cccggggccgggggcggcggcggcccctcgcagcagctggccggcgggcccccccagcag
ttcgcgctctccaactccgcggccatccgggccgagatccagcgcttcgagtccgtgcat
cccaatatctacgccatctacgacctgatcgagcgcatcgaggatttggcgctgcagaac
cagatccgggagcacgtcatctccatcgaggactcgtttgtgaacagccaggagtggacg
ctgagccgctccgtaccggagcttaaagtgggcatagtggggaacctgtctagcgggaag
tcagccctggtgcaccgctatctgacggggacctatgtccaggaggagtcccctgaaggg
gggcggtttaagaaggagattgtggtggatggccagagttacctgctgctgatccgagat
gaaggaggcccccctgagctccagtttgctgcctgggtggatgcagtggtgtttgtgttc
agcctggaggatgaaatcagtttccagacggtgtacaactacttcctgcgtctctgcagc
ttccgcaacgccagcgaggtgcccatggtgcttgtgggcacgcaggatgccatcagcgct
gcgaatccccgggttatcgacgacagcagagcccgcaagctctccacagatctgaagcgg
tgcacctactatgagacgtgcgcgacctacgggctcaatgtggagcgtgtcttccaggac
gtggcccagaaggtagtggccttgcgaaagaagcagcaactggccatcgggccctgcaag
tcactgcccaactcgcccagccactcggccgtgtccgccgcctccatcccggccgtgcac
atcaaccaggccacgaatggcggcggcagcgccttcagcgactactcgtcctcagtcccc
tccacccccagcatcagccagcgggagctgcgcatcgagaccatcgctgcctcctccacc
cccacacccatccgaaagcagtccaagcggcgctccaacatcttcacgtctcggaagggt
gctgacctggaccgggagaagaaggctgccgagtgcaaggtggacagcatcgggagcggc
cgcgccatccccatcaagcaggggatcctgctaaagcggagcggcaagtccctgaacaag
gagtggaagaagaagtatgtgacgctctgtgacaacgggctgctcacctatcaccccagc
ctgcatgattacatgcagaacatccacggcaaggagattgacctgctgcggacaacggtg
aaagtgccagggaagcgcctgccccgagccacacctgccacagccccgggcaccagcccc
cgtgccaacgggctgtccgtggagcggagtaacacacagctgggtgggggcacaggtgcc
ccccactcggccagcagcgcatccctgcactctgagcgccccctcagcagctcggcctgg
gctggcccgcgccctgaggggctgcaccagcgctcctgctccgtttccagcgccgaccag
tggagtgaggccaccacttccctgcccccaggcatgcagcaccctgccagtggcccagct
gaggtactcagttccagccccaagctggatcctcccccatctccccactccaaccggaag
aagcaccggaggaaaaagagcaccgggaccccccgaccagacggccccagcagtgctact
gaagaggcagaggagtcgtttgaatttgtggtggtgtccctcactgggcagacgtggcac
ttcgaggcttcaacggcggaggagcgggagctgtgggttcagagtgtgcaggcccagatc
cttgccagcctgcaaggctgccgcagtgccaaggacaagactcgactggggaaccagaac
gcagctctggctgtgcaggccgtccgcaccgtccgcggcaacagcttttgtatcgactgc
gatgcacccaatccagactgggccagcctgaacctgggtgccctgatgtgcattgagtgc
tcaggcatccaccgacacctgggggctcacctgtcccgggtgcgctcccttgacctcgat
gactggccgcctgagctgctggctgtcatgactgccatgggcaatgccctcgccaacagc
gtctgggagggggccttgggtggctactccaagccagggcctgatgcctgcagagaggag
aaggaacgctggatacgggccaagtatgaacagaagctcttcctggccccactgccaagc
tcagatgtgccactggggcagcagctgctccgggccgtggtggaagatgacctgcggctg
ttggtgatgctcctggcacatggctccaaagaggaggtgaatgagacctatggggacggg
gacgggcggacggctctacatctctccagtgccatggccaacgttgtcttcacgcagctg
ctcatctggtacggggtggacgtgaggagccgggacgcccggggcctgactccactggca
tatgctcgccgggccggcagccaggagtgtgcagacatcttgatccagcatggctgccct
ggggagggctgtggcttagcgcctacccccaacagagagcctgccaatggcaccaacccc
tctgctgagctgcaccgtagtcctagcctcctataa

KEGG   Homo sapiens (human): 119016
Entry
119016            CDS       T01001                                 
Symbol
AGAP4, AGAP-4, AGAP-8, AGAP8, CTGLF1, CTGLF5, MRIP2
Name
(RefSeq) ArfGAP with GTPase domain, ankyrin repeat and PH domain 4
  KO
K12491  Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1/3/4/5/6/9/11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    119016 (AGAP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    119016 (AGAP4)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    119016 (AGAP4)
SSDB
Motif
Pfam: ArfGap PH Ank_2 Ank Ank_5 Ank_4 PH_11 Ank_3 PH_8 PH_6 PH_4
Other DBs
NCBI-GeneID: 119016
NCBI-ProteinID: NP_597703
HGNC: 23459
Ensembl: ENSG00000188234
Pharos: Q96P64(Tdark)
UniProt: Q96P64
LinkDB
Position
10:complement(45825594..45854690)
AA seq 663 aa
MGNILTCRVHPSVSLEFDQQQGSVCPSESEIYEAGAGDRMAGAPMAAAVQPAEVTVEVGE
DLHMHHVRDREMPEALEFNPSANPEASTIFQRNSQTDVVEIRRSNCTNHVSTVRFSQQYS
LCSTIFLDDSTAIQHYLTMTIISVTLEIPHHITQRDADRSLSIPDEQLHSFAVSTVHIMK
KRNGGGSLNNYSSSIPSTPSTSQEDPQFSVPPTANTPTPVCKRSMRWSNLFTSEKGSDPD
KERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTWKKKYVTLCSNGVLTYYSSLGDYM
KNIHKKEIDLQTSTIKVPGKWPSLATSACTPISTSKSNGLSKDMDTGLGDSICFSPSISS
TTSPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQTWHFEATTYEERDAWVQAIQSQIL
ASLQSCESSKSKSQLTSQSKAMALQSIQNMRGNAHCVDCETQNPKWASLNLGVLMCIECS
GIHRSLGTRLSRVRSLELDDWPVELRKVMSSIGNDLANSIWEGSSQGQTKPSEKSTREEK
ERWIRSKYEEKLFLAPLPCTELSLGQQLLRATADEDLQTAILLLAHGSREEVNETCGEGD
GCTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTALTYARQASSQECINVLLQYGCPD
KCV
NT seq 1992 nt   +upstreamnt  +downstreamnt
atggggaacatactgacctgtcgtgtgcaccctagcgtcagcctcgagtttgaccagcag
caggggtcggtgtgtccctctgaatctgagatctatgaggcaggagctggggacaggatg
gcaggagcgcccatggctgctgctgtacagcctgctgaggtgactgttgaagttggtgag
gacctccacatgcaccacgttcgtgaccgggagatgcctgaagctttggagtttaaccct
tctgccaatccagaggcaagcacaatattccagaggaactctcaaacagatgttgtagaa
ataagaagaagcaactgtacaaaccatgtatctactgtgcgtttcagtcaacaatacagc
ttgtgttcgacaatattccttgatgacagcacagccatccagcattatcttacaatgaca
ataatatctgtgaccttggagatacctcatcatatcacacaaagagatgcagatagatct
ttgagcatacctgatgaacagttacactcatttgcggtttccaccgtgcacattatgaag
aaaagaaatggaggtgggagtttaaataactattcctcctccattccatcgactcccagc
accagccaggaggaccctcagttcagtgttcctcccactgccaacacacccacccccgtt
tgcaagcggtccatgcgctggtccaacctgtttacatctgagaaagggagtgacccagac
aaagagaggaaagccccggagaatcatgctgacaccatcgggagcggcagagccatcccc
attaaacagggcatgctcttaaagcgaagtgggaaatggctgaagacatggaaaaagaaa
tacgtcaccctgtgttccaatggcgtgctcacctattattcaagcttaggtgattatatg
aagaatattcataaaaaagagattgaccttcagacatctaccatcaaagtcccaggaaag
tggccatccctagccacatcggcctgcacacccatctccacctctaaaagcaatggccta
tccaaggacatggacaccgggctgggtgactccatatgcttcagccccagtatctccagc
accaccagccccaagctcaacccgcccccctctcctcatgccaataaaaagaaacaccta
aagaagaaaagcaccaacaactttatgattgtgtctgccactggccaaacgtggcacttt
gaagccacgacgtatgaggagcgggatgcctgggtccaagccatccagagccagatcctg
gccagcctgcagtcatgcgagagcagtaaaagcaagtcccagctgaccagccagagcaag
gccatggccctgcagtcgatccaaaacatgcgtgggaacgcccactgtgtggactgtgag
acccagaatcctaagtgggccagtttgaacttgggagtcctcatgtgtattgaatgctca
ggaatccaccgcagtcttggcacccgcctttcccgtgtgcgatctctggagctggatgac
tggccagttgagctcaggaaggttatgtcatctattggcaatgacctagccaacagcatc
tgggaagggagcagccaggggcagacaaaaccctcagaaaagtccacgagggaagagaag
gaacggtggatccgttccaaatatgaggagaagctctttctggccccactaccctgcact
gagctgtccctgggccagcagctgctgcgggccaccgctgatgaggacctgcagacagcc
atcctgctgctggcacatggctcccgtgaggaggtgaacgagacctgtggggagggagac
ggctgcacggcgctccatctggcctgccgcaaggggaatgtggtcctggcgcagctcctg
atctggtacggggtggacgtcatggcccgagatgcccacgggaacacagcgctgacctac
gcccggcaggcctccagccaggagtgcatcaacgtgcttctgcagtacggctgccccgac
aagtgtgtgtag

KEGG   Homo sapiens (human): 23527
Entry
23527             CDS       T01001                                 
Symbol
ACAP2, CENTB2, CNT-B2
Name
(RefSeq) ArfGAP with coiled-coil, ankyrin repeat and PH domains 2
  KO
K12489  Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    23527 (ACAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23527 (ACAP2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    23527 (ACAP2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    23527 (ACAP2)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    23527 (ACAP2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   23527 (ACAP2)
SSDB
Motif
Pfam: BAR_3 ArfGap PH Ank_2 Ank_5 Ank Ank_4 Ank_3 PH_8 PH_11
Other DBs
NCBI-GeneID: 23527
NCBI-ProteinID: NP_036419
OMIM: 607766
HGNC: 16469
Ensembl: ENSG00000114331
Pharos: Q15057(Tdark)
UniProt: Q15057
Structure
LinkDB
Position
3:complement(195274745..195443020)
AA seq 778 aa
MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQFM
NGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKF
KDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILTATRKCFRHIALDYVLQINVL
QSKRRSEILKSMLSFMYAHLAFFHQGYDLFSELGPYMKDLGAQLDRLVVDAAKEKREMEQ
KHSTIQQKDFSSDDSKLEYNVDAANGIVMEGYLFKRASNAFKTWNRRWFSIQNNQLVYQK
KFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWIKAVQTSI
ATAYREKGDESEKLDKKSSPSTGSLDSGNESKEKLLKGESALQRVQCIPGNASCCDCGLA
DPRWASINLGITLCIECSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNDVINRVYE
ANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLS
ISKFGPGDQVRASAQSSVRSNDSGIQQSSDDGRESLPSTVSANSLYEPEGERQDSSMFLD
SKHLNPGLQLYRASYEKNLPKMAEALAHGADVNWANSEENKATPLIQAVLGGSLVTCEFL
LQNGANVNQRDVQGRGPLHHATVLGHTGQVCLFLKRGANQHATDEEGKDPLSIAVEAANA
DIVTLLRLARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF
NT seq 2337 nt   +upstreamnt  +downstreamnt
atgaagatgactgtggatttcgaggagtgtctgaaggactcgccccgcttcagggcagct
ttggaagaagtagaaggtgatgtggcagaattggaactaaaacttgataagcttgtgaaa
ctttgtattgcaatgattgatactggaaaagccttttgtgttgcaaataaacagttcatg
aatgggattcgagacctggctcagtattctagtaatgatgctgtcgttgagacaagtttg
accaagttttctgacagtcttcaagaaatgataaattttcacacaatcctgtttgaccaa
actcagagatcaattaaggcacagcttcagaactttgttaaagaagatcttagaaaattc
aaagatgccaagaagcaattcgaaaaagtcagtgaagaaaaagaaaatgcgttagtaaaa
aatgcccaagtacaaagaaacaaacaacatgaagttgaagaagccaccaacattctgaca
gcaacaagaaaatgtttccgacacatagccctcgattatgtgcttcagattaatgttctt
caatcaaaaaggagatcagaaatcctaaaatcaatgttgtcatttatgtatgcccatttg
gccttctttcatcaaggatatgatctgtttagtgaacttggaccctacatgaaggatctt
ggtgcacagttggatcgactggttgtggatgcagcaaaggagaaaagagaaatggagcaa
aaacattccaccattcaacaaaaggatttctccagtgatgattctaagttagaatataac
gtagatgctgcaaatggcatagttatggaaggatatctgttcaaacgagccagcaatgcc
ttcaaaacttggaacaggcgctggttttcaatacagaataatcagttggtttaccagaaa
aaatttaaggataatccgactgtggtagttgaagacctcaggctttgcacagtgaaacat
tgtgaagacatagagcgacgattctgctttgaggtggtctcgccaacaaaaagttgcatg
ctccaggcagattccgaaaagctgcgccaggcatggattaaggctgttcagaccagtatt
gctactgcttatagagagaagggtgatgaatcagagaagctggataagaaatcatctcca
tccacaggaagcctagattctggaaatgagtccaaagagaaattattgaaaggagaaagt
gcgcttcagcgggtccagtgtatccctggcaatgccagctgttgtgactgtggcctggca
gatccacggtgggccagcatcaacctgggcatcaccttgtgtatcgagtgctccggaatt
caccggagccttggggttcatttttcaaaagtacgatctttaactttagacacctgggag
ccagaacttttaaagcttatgtgtgagttggggaatgatgttataaatcgagtttatgaa
gctaatgtggaaaaaatgggaataaagaaaccccaaccaggacaaagacaggagaaggag
gcatatatcagagcaaaatatgtggagaggaaatttgtggataaatattctatatcatta
tcacctcctgagcagcaaaaaaagtttgtctctaaaagttctgaagaaaagaggctgagc
atttctaaatttgggccaggggaccaagtcagagcatctgcccaaagttcagtcagaagt
aatgacagtggaattcagcagagctctgatgatggaagagaatctttaccctccacggtg
tcagccaatagtttatatgagcctgaaggagaaaggcaagattcttctatgtttcttgac
tcgaaacatcttaatccaggacttcagctttatagggcgtcatatgaaaaaaaccttcct
aaaatggctgaggctttggctcatggtgcagacgtgaactgggccaattcagaggaaaac
aaagcgacaccacttattcaggctgtattagggggctctttggtgacgtgtgagttcctc
ctacagaatggtgctaatgtcaaccaaagagatgtccaagggcggggaccattgcaccat
gccaccgtcttagggcacacagggcaggtatgtttattcctaaaacgaggtgccaatcaa
catgccactgatgaagaagggaaagaccctttgagcatagctgtggaagcagccaatgct
gatatagtcaccttgttacgtttagcaagaatgaatgaagagatgcgggaatcagaagga
ctttatggacagccaggtgatgaaacttatcaggacatatttcgtgatttttcccaaatg
gcatccaataatccagagaaactaaatcgtttccagcaagattcacagaaattctga

KEGG   Homo sapiens (human): 26286
Entry
26286             CDS       T01001                                 
Symbol
ARFGAP3, ARFGAP1
Name
(RefSeq) ADP ribosylation factor GTPase activating protein 3
  KO
K12493  ADP-ribosylation factor GTPase-activating protein 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    26286 (ARFGAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    26286 (ARFGAP3)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    26286 (ARFGAP3)
SSDB
Motif
Pfam: ArfGap TMF_DNA_bd
Other DBs
NCBI-GeneID: 26286
NCBI-ProteinID: NP_055385
OMIM: 612439
HGNC: 661
Ensembl: ENSG00000242247
Pharos: Q9NP61(Tbio)
UniProt: Q9NP61 A0A024R4U0
Structure
LinkDB
Position
22:complement(42796502..42857273)
AA seq 516 aa
MGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLS
FIRSTELDSNWSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSL
ASQATRKHGTDLWLDSCVVPPLSPPPKEEDFFASHVSPEVSDTAWASAIAEPSSLTSRPV
ETTLENNEGGQEQGPSVEGLNVPTKATLEVSSIIKKKPNQAKKGLGAKKGSLGAQKLANT
CFNEIEKQAQAADKMKEQEDLAKVVSKEESIVSSLRLAYKDLEIQMKKDEKMNISGKKNV
DSDRLGMGFGNCRSVISHSVTSDMQTIEQESPIMAKPRKKYNDDSDDSYFTSSSSYFDEP
VELRSSSFSSWDDSSDSYWKKETSKDTETVLKTTGYSDRPTARRKPDYEPVENTDEAQKK
FGNVKAISSDMYFGRQSQADYETRARLERLSASSSISSADLFEEPRKQPAGNYSLSSVLP
NAPDMAQFKQGVRSVAGKLSVFANGVVTSIQDRYGS
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgggggaccccagcaagcaggacatcttgaccatcttcaagcgcctccgctcggtgccc
actaacaaggtgtgttttgattgtggtgccaaaaatcccagctgggcaagcataacctat
ggagtgttcctttgcattgattgctcagggtcccaccggtcacttggtgttcacttgagt
tttattcgatctacagagttggattccaactggtcatggtttcagttgcgatgcatgcaa
gtcggaggaaacgctagtgcatcttccttttttcatcaacatgggtgttccaccaatgac
accaatgccaagtacaacagtcgtgctgctcagctctatagggagaaaatcaaatcgctc
gcctctcaagcaacacggaagcatggcactgatctgtggcttgatagttgtgtggttcca
cctttgtcccctccaccaaaggaggaagatttttttgcctctcacgtttctcctgaggtg
agtgacacagcgtgggcatcagcaatagcagaaccatcttctttaacatcaaggcctgtg
gaaaccactttggaaaataatgaaggtggacaagagcaaggaccaagtgtggaaggtctt
aatgtaccaacaaaggctactttagaggtatcctctatcataaaaaagaaaccaaatcaa
gctaaaaaaggccttggggccaaaaaaggaagtttgggagctcagaaactggcaaacaca
tgctttaatgaaattgaaaaacaagctcaagctgcggataaaatgaaggagcaggaagac
ctggccaaggtggtatctaaagaagaatcaattgtttcatcattacgattagcctataag
gatcttgaaattcaaatgaagaaagacgaaaagatgaacattagtggcaaaaaaaatgtt
gactcagacagactcggcatgggatttggaaattgcagaagtgttatttcacattcagtg
acttcagatatgcagaccatagagcaggaatcacccattatggcaaaaccaagaaaaaag
tataatgatgacagtgacgattcatattttacttccagctcaagttactttgacgagcca
gtggagttaaggagcagttctttctctagctgggatgacagttcagattcctattggaaa
aaagagaccagcaaagatactgaaacagttctgaaaaccacaggctattcagacagacct
actgctcgccgcaagccagattatgagccagttgaaaatacagatgaggcccagaagaag
tttggcaatgtcaaggccatttcatcagatatgtattttggaagacaatcccaggctgat
tatgagaccagggcccgcctagagaggctgtcggcaagttcctccataagctcggctgat
ctgttcgaggagccgaggaagcagccagcagggaactacagcctgtccagtgtgctgccc
aacgcccccgacatggcgcagttcaagcagggagtgagatcggttgctggaaaactctcc
gtctttgctaatggagtcgtgacttcaattcaggatcgctacggttcttaa

KEGG   Homo sapiens (human): 28964
Entry
28964             CDS       T01001                                 
Symbol
GIT1, p95-APP1
Name
(RefSeq) GIT ArfGAP 1
  KO
K05737  G protein-coupled receptor kinase interactor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    28964 (GIT1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    28964 (GIT1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    28964 (GIT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    28964 (GIT1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    28964 (GIT1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    28964 (GIT1)
SSDB
Motif
Pfam: GIT1_C GIT_CC ArfGap GIT_SHD Ank_2 Ank_4 Ank_5 Shugoshin_N Ank ZapB YabA SAM_KSR1 TTRAP
Other DBs
NCBI-GeneID: 28964
NCBI-ProteinID: NP_054749
OMIM: 608434
HGNC: 4272
Ensembl: ENSG00000108262
Pharos: Q9Y2X7(Tbio)
UniProt: Q9Y2X7
LinkDB
Position
17:complement(29573475..29589648)
AA seq 761 aa
MSRKGPRAEVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTL
LQMVHTLASNGANSIWEHSLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKL
PCRDDDGVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQT
LQAELLVVYGADPGSPDVNGRTPIDYARQAGHHELAERLVECQYELTDRLAFYLCGRKPD
HKNGHYIIPQMADSLDLSELAKAAKKKLQALSNRLFEELAMDVYDEVDRRENDAVWLATQ
NHSTLVTERSAVPFLPVNPEYSATRNQGRQKLARFNAREFATLIIDILSEAKRRQQGKSL
SSPTDNLELSLRSQSDLDDQHDYDSVASDEDTDQEPLRSTGATRSNRARSMDSSDLSDGA
VTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRRLQREIHKLQAENLQLRQPPGPVPT
PPLPSERAEHTPMAPGGSTHRRDRQAFSMYEPGSALKPFGGPPGDELTTRLQPFHSTELE
DDAIYSVHVPAGLYRIRKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYEN
TQSGDPLLGLEGKRFLELGKEEDFHPELESLDGDLDPGLPSTEDVILKTEQVTKNIQELL
RAAQEFKHDSFVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYRLQSECRKTV
PPEPGAPVDFQLLTQQVIQCAYDIAKAAKQLVTITTREKKQ
NT seq 2286 nt   +upstreamnt  +downstreamnt
atgtcccgaaaggggccgcgagcggaggtgtgtgcggactgcagcgccccggaccctggc
tgggcatccatcagcaggggtgtgctggtgtgtgacgagtgctgcagcgtgcaccggagc
ctgggacgccacatctccattgtcaagcaccttcgccacagcgcctggcctcccacgctg
ctgcagatggtgcacacgcttgccagcaacggggccaactccatctgggagcactccctg
ctggaccccgcacaagtgcagagcggccggcgtaaagccaacccccaagacaaagtccac
cccatcaagtcagagttcatcagggccaagtaccagatgctggcatttgtgcacaagctt
ccctgccgggacgatgatggagtcaccgccaaagacctcagcaagcaactacactcgagc
gtgcggacaggcaacctggagacatgtctgcgcctgctctccctgggtgcccaggccaac
ttcttccacccagagaagggcaccacacctctgcacgtggctgccaaggcaggacagaca
ctgcaggccgagctgcttgtagtgtatggggctgaccctggctcccctgatgttaatggc
cgcacacccattgactatgccaggcaggcggggcaccatgagctggcggaaaggctggtt
gagtgccaatatgagctcactgaccggctggccttctacctctgtggacgcaagccggat
cacaagaatgggcattacatcatcccacagatggctgacagccttgacttatccgaattg
gccaaagctgctaagaagaagctgcaggcgctcagcaaccggctttttgaggaactcgcc
atggacgtgtatgacgaggtggatcgaagagaaaatgatgcagtgtggctggctacccaa
aaccacagcactctggtgacagagcgcagtgccgtgcccttcctgcctgttaacccggaa
tactcagccacgcggaatcaggggcgacaaaagctggcccgctttaatgcccgagagttt
gccaccttgatcatcgacattctcagtgaggccaagcggagacagcagggcaagagcctg
agcagccccacagacaacctcgagctgtctctgcggagccagagtgacctcgacgaccaa
cacgactacgacagcgtggcctctgacgaggacacagaccaggagcccctgcgcagcacc
ggcgccactcggagcaaccgggcccggagcatggactcctcggacttgtctgacggggct
gtgacgctgcaggagtacctggagctgaagaaggccctggctacatcggaggcaaaggtg
cagcagctcatgaaggtcaacagtagcctgagcgacgagctccggaggctgcagcgagag
atccacaagctgcaggcggagaacctgcagctccggcagcctccagggccggtgcccaca
cctccactccccagtgaacgggcggaacacacacccatggcgccaggcgggagcacacac
cgcagggatcgccaggccttttccatgtatgaacctggctctgccctgaagccctttggg
ggcccccctggggacgagctcactacgcggctgcagcctttccacagcactgagctagag
gacgacgccatctattcagtgcacgtccctgctggcctttaccggatccggaaaggggtg
tctgcctcagctgtgcccttcactccctcctccccgctgctgtcctgctcccaggaggga
agccgccacacgagcaagctttcccgccacggcagtggagccgacagtgactatgagaac
acgcaaagtggggacccactgctggggctggaagggaagaggtttctagagctgggcaaa
gaggaagacttccacccagagctggaaagcctggatggagacctagatcctgggcttccc
agcacagaggatgtcatcttgaagacagagcaggtcaccaagaacattcaggaactgttg
cgggcagcccaggagttcaagcatgacagcttcgtgccctgctcagagaagatccatttg
gctgtgaccgagatggcctccctcttcccaaagaggccagccctggagccagtgcggagc
tcactgcggctgctcaacgccagcgcctaccggctgcagagtgagtgccggaagacagtg
cccccagagcccggcgccccagtggacttccagctgctgactcagcaggtgatccagtgc
gcctatgacatcgccaaggctgccaagcagctggtcaccatcaccacccgagagaagaag
cagtga

KEGG   Homo sapiens (human): 414189
Entry
414189            CDS       T01001                                 
Symbol
AGAP6, AGAP-6, CTGLF3
Name
(RefSeq) ArfGAP with GTPase domain, ankyrin repeat and PH domain 6
  KO
K12491  Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1/3/4/5/6/9/11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    414189 (AGAP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    414189 (AGAP6)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    414189 (AGAP6)
SSDB
Motif
Pfam: ArfGap PH Ank_2 Ank Ank_5 Ank_4 PH_11 Ank_3 PH_8 PH_6 PH_4 PH_20
Other DBs
NCBI-GeneID: 414189
NCBI-ProteinID: NP_001071133
HGNC: 23466
Ensembl: ENSG00000204149
Pharos: Q5VW22(Tdark)
UniProt: Q5VW22
LinkDB
Position
10:49988368..50010499
AA seq 686 aa
MGNILTCRVHPSVSLEFDQQQGSVCPSESETYEAGARDRMAGAPMAAAVQPAEVTVEVGE
DLHMHHVRDREMPEALEFNLSANPESSTIFQRNSQTEALEFNPSANPEASTIFQRNSQTD
VVEIRRSNCTNHVSAVRFSQQYSLCSTIFLDDSTAIQHYLTMTIISVTLEIPHHITQRDA
DRTLSIPDEQLHSFAVSTVHIMKKRNGGGSLNNYSSSIPSTPSTSQEDPQFSVPPTANTP
TPVCKRSMRWSNLFTSEKGSDPDKERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTW
KKKYVTLCSNGMLTYYSSLGDYMKNIHKKEIDLQTSTIKVPGKWPSLATSACTPISSSKS
NGLSKDMDTGLGDSICFSPSISSTTSPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQT
WHFEATTYEERDAWVQAIQSQILASLQSCESSKSKSQLTSQSEAMALQSIQNMRGNAHCV
DCETQNPKWASLNLGVLMCIECSGIHRSLGPHLSRVRSLELDDWPVELRKVMSSIVNDLA
NSIWEGSSQGQTKPSEKSTREEKERWIRSKYEEKLFLAPLPCTELSLGQQLLRATADEDL
QTAILLLAHGSCEEVNETCGEGDGCTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTA
LTYARQASSQECINVLLQYGCPDECV
NT seq 2061 nt   +upstreamnt  +downstreamnt
atggggaacatactgacctgtcgtgtgcaccctagcgtcagcctcgagtttgaccagcag
caggggtcggtgtgtccctctgaatctgagacctatgaggcaggagctagggacaggatg
gcaggagcgcccatggctgctgctgtacagcctgctgaggtgactgttgaagttggtgag
gacctccacatgcaccacgttcgtgaccgggagatgcctgaagctttggagtttaacctt
tctgccaatccagagtcaagcacaatattccagaggaactctcaaacagaagctttggag
tttaacccttctgccaatccagaggcaagcacaatattccagaggaactctcaaacagat
gttgtagaaataagaagaagcaactgtacaaaccatgtatctgctgtgcgtttcagtcaa
caatacagcttgtgttcgacaatattccttgatgacagcacagccatccagcattatctt
acaatgacaataatatctgtgaccttggagatacctcatcatatcacacaaagagatgca
gatagaactttgagcatacctgatgaacagttacactcatttgcggtttccaccgtgcac
attatgaagaaaagaaatggaggtgggagtttaaataactattcctcctccattccatcg
actcccagcaccagccaggaggaccctcagttcagtgttcctcccactgccaacacaccc
acgcccgtttgcaagcggtccatgcgctggtccaacctgtttacatctgagaaagggagt
gacccagacaaagagaggaaagccccggagaatcatgctgacaccatcgggagcggtaga
gccatccccattaaacagggcatgctcttaaagcgaagtgggaaatggctgaagacatgg
aaaaagaaatacgtcaccctgtgttccaatggcatgctcacctattattcaagcttaggt
gattatatgaagaatattcataaaaaagagattgaccttcagacatctaccatcaaagtc
ccaggaaagtggccatccctagccacatcggcctgcacacccatctccagctctaaaagc
aatggcctatccaaggacatggacaccgggctgggtgactccatatgcttcagccccagt
atctccagcaccaccagccccaagctcaacccgcccccctctcctcatgctaataaaaag
aaacacctaaagaagaaaagcaccaacaactttatgattgtgtctgccactggccaaacg
tggcactttgaagccacgacgtatgaggagcgggatgcctgggtccaagccatccagagc
cagatcctggccagcctgcagtcatgcgagagcagtaaaagcaagtcccagctgaccagc
cagagcgaggccatggccctgcagtcgatccaaaacatgcgtgggaacgcccactgtgtg
gactgtgagacccagaatcctaagtgggccagtttgaacttgggagtcctcatgtgtatt
gaatgctcaggtatccaccgcagtcttggcccccacctttcccgtgtgcgatctctggag
ctggatgactggccagttgagctcaggaaggttatgtcatctattgtcaatgacctagcc
aacagcatctgggaagggagcagccaggggcagacaaaaccctcagaaaagtccacgagg
gaagagaaggaacggtggatccgttccaaatatgaggagaagctctttctggccccacta
ccctgcactgagctgtccctgggccagcagctgctgcgggccaccgctgatgaggacctg
cagacagccatcctgctgctggcacatggctcctgtgaggaggtgaacgagacctgtggg
gagggagacggctgcacggcgctccatctggcctgccgcaaggggaatgtggtcctggcg
cagctcctgatctggtacggggtggacgtcatggcccgagatgcccacgggaacacagcg
ctgacctacgcccggcaggcctccagccaggagtgcatcaacgtgcttctgcagtacggc
tgccccgacgagtgtgtgtag

KEGG   Homo sapiens (human): 50807
Entry
50807             CDS       T01001                                 
Symbol
ASAP1, AMAP1, CENTB4, DDEF1, PAG2, PAP, ZG14P
Name
(RefSeq) ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
  KO
K12488  Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    50807 (ASAP1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    50807 (ASAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    50807 (ASAP1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    50807 (ASAP1)
SSDB
Motif
Pfam: ArfGap BAR_3 Ank_2 PH SH3_9 SH3_1 BAR Ank SH3_2 Ank_4 Ank_3 Ank_5 PH_3
Other DBs
NCBI-GeneID: 50807
NCBI-ProteinID: NP_060952
OMIM: 605953
HGNC: 2720
Ensembl: ENSG00000153317
Pharos: Q9ULH1(Tbio)
UniProt: Q9ULH1
Structure
LinkDB
Position
8:complement(130052104..130443674)
AA seq 1129 aa
MRSSASRLSSFSSRDSLWNRMPDQISVSEFIAETTEDYNSPTTSSFTTRLHNCRNTVTLL
EEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQVLDKFGSNFLSRDNPDLGTAFVK
FSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKI
EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
QKEDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGIRKVWQRRKCSVKNGILTISHAT
SNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYVAWISVLTNSKEEALT
MAFRGEQSAGENSLEDLTKAIIEDVQRLPGNDICCDCGSSEPTWLSTNLGILTCIECSGI
HREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPSPSPKPTPSSDMTVRK
EYITAKYVDHRFSRKTCSTSSAKLNELLEAIKSRDLLALIQVYAEGVELMEPLLEPGQEL
GETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTALGNTVLHYCSMYSKPECLKLLLRSK
PTVDIVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEYEWNLRQEEIDESDDD
LDDKPSPIKKERSPRPQSFCHSSSISPQDKLALPGFSTPRDKQRLSYGAFTNQIFVSTST
DSPTSPTTEAPPLPPRNAGKGPTGPPSTLPLSTQTSSGSSTLSKKRPPPPPPGHKRTLSD
PPSPLPHGPPNKGAVPWGNDGGPSSSSKTTNKFEGLSQQSSTSSAKTALGPRVLPKLPQK
VALRKTDHLSLDKATIPPEIFQKSSQLAELPQKPPPGDLPPKPTELAPKPQIGDLPPKPG
ELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLK
SHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQA
DNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD
NT seq 3390 nt   +upstreamnt  +downstreamnt
atgagatcttcagcctccaggctctccagtttttcgtcgagagattcactatggaatcgg
atgccggaccagatctctgtctcggagttcatcgccgagaccaccgaggactacaactcg
cccaccacgtccagcttcaccacgcggctgcacaactgcaggaacaccgtcacgctgctg
gaggaggctctagaccaagatagaacagcccttcagaaagtgaagaagtctgtaaaagca
atatataattctggtcaagatcatgtacaaaatgaagaaaactatgcacaagttcttgat
aagtttgggagtaattttttaagtcgagacaaccccgaccttggcaccgcgtttgtcaag
ttttctactcttacaaaggaactgtccacactgctgaaaaatctgctccagggtttgagc
cacaatgtgatcttcaccttggattctttgttaaaaggagacctaaagggagtcaaagga
gatctcaagaagccatttgacaaagcctggaaagattatgagacaaagtttacaaaaatt
gagaaagagaaaagagagcacgcaaaacaacatgggatgatccgcacagagataacagga
gctgagattgcggaagaaatggagaaggaaaggcgcctctttcagctccaaatgtgtgaa
tatctcattaaagttaatgaaatcaagaccaaaaagggtgtggatctgctgcagaatctt
ataaagtattaccatgcacagtgcaatttctttcaagatggcttgaaaacagctgataag
ttgaaacagtacattgaaaaactggctgctgatttatataatataaaacagacccaggat
gaagaaaagaaacagctaactgcactccgagacttaataaaatcctctcttcaactggat
cagaaagaagattctcagagccggcaaggaggatacagcatgcatcagctccagggcaat
aaggaatatggcagtgaaaagaaggggtacctgctaaagaaaagtgacgggatccggaaa
gtatggcagaggaggaagtgttcagtcaagaatgggattctgaccatctcacatgccaca
tctaacaggcaaccagccaagttgaaccttctcacctgccaagtaaaacctaatgccgaa
gacaaaaaatcttttgacctgatatcacataatagaacatatcactttcaggcagaagat
gagcaggattatgtagcatggatatcagtattgacaaatagcaaagaagaggccctaacc
atggccttccgtggagagcagagtgcgggagagaacagcctggaagacctgacaaaagcc
attattgaggatgtccagcggctcccagggaatgacatttgctgcgattgtggctcatca
gaacccacctggctttcaaccaacttgggtattttgacctgtatagaatgttctggcatc
catagggaaatgggggttcatatttctcgcattcagtctttggaactagacaaattagga
acttctgaactcttgctggccaagaatgtaggaaacaatagttttaatgatattatggaa
gcaaatttacccagcccctcaccaaaacccaccccttcaagtgatatgactgtacgaaaa
gaatatatcactgcaaagtatgtagatcataggttttcaaggaagacctgttcaacttca
tcagctaaactaaatgaattgcttgaggccatcaaatccagggatttacttgcactaatt
caagtctatgcagaaggggtagagctaatggaaccactgctggaacctgggcaggagctt
ggggagacagcccttcaccttgccgtccgaactgcagatcagacatctctccatttggtt
gacttccttgtacaaaactgtgggaacctggataagcagacggccctgggaaacacagtt
ctacactactgtagtatgtacagtaaacctgagtgtttgaagcttttgctcaggagcaag
cccactgtggatatagttaaccaggctggagaaactgccctagacatagcaaagagacta
aaagctacccagtgtgaagatctgctttcccaggctaaatctggaaagttcaatccacac
gtccacgtagaatatgagtggaatcttcgacaggaggagatagatgagagcgatgatgat
ctggatgacaaaccaagccctatcaagaaagagcgctcacccagacctcagagcttctgc
cactcctccagcatctccccccaggacaagctggcactgccaggattcagcactccaagg
gacaaacagcggctctcctatggagccttcaccaaccagatcttcgtttccacaagcaca
gactcgcccacatcaccaaccacggaggctccccctctgcctcctaggaacgccgggaaa
ggtccaactggcccaccttcaacactccctctaagcacccagacctctagtggcagctcc
accctatccaagaagaggcctcctcccccaccacccggacacaagagaaccctatccgac
cctcccagcccactacctcatgggcccccaaacaaaggcgcagttccttggggtaacgat
gggggtccatcctcttcaagtaagactacaaacaagtttgagggactatcccagcagtcg
agcaccagttctgcaaagactgcccttggcccaagagttcttcctaaactacctcagaaa
gtggcactaaggaaaacagatcatctctccctagacaaagccaccatcccgcccgaaatc
tttcagaaatcatcacagttggcagagttgccacaaaagccaccacctggagacctgccc
ccaaagcccacagaactggcccccaagccccaaattggagatttgccgcctaagccagga
gaactgccccccaaaccacagctgggggacctgccacccaaaccccaactctcagactta
cctcccaaaccacagatgaaggacctgccccccaaaccacagctgggagacctgctagca
aaatcccagactggagatgtctcacccaaggctcagcaaccctctgaggtcacactgaag
tcacacccattggatctatccccaaatgtgcagtccagagacgccatccaaaagcaagca
tctgaagactccaacgacctcacgcctactctgccagagacgcccgtaccactgcccaga
aaaatcaatacggggaaaaataaagtgaggcgagtgaagaccatttatgactgccaggca
gacaacgatgacgagctcacattcatcgagggagaagtgattatcgtcacaggggaagag
gaccaggagtggtggattggccacatcgaaggacagcctgaaaggaagggggtctttcca
gtgtcctttgttcatatcctgtctgactag

KEGG   Homo sapiens (human): 55616
Entry
55616             CDS       T01001                                 
Symbol
ASAP3, ACAP4, CENTB6, DDEFL1, UPLC1
Name
(RefSeq) ArfGAP with SH3 domain, ankyrin repeat and PH domain 3
  KO
K12488  Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    55616 (ASAP3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    55616 (ASAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55616 (ASAP3)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    55616 (ASAP3)
SSDB
Motif
Pfam: ArfGap BAR_3 PH Ank_2 Ank_5 Ank_4 Ank Ank_3 DUF3287 PH_2 PH_3 PH_13
Other DBs
NCBI-GeneID: 55616
NCBI-ProteinID: NP_060177
OMIM: 616594
HGNC: 14987
Ensembl: ENSG00000088280
Pharos: Q8TDY4(Tbio)
UniProt: Q8TDY4 A0A024RAB1
Structure
LinkDB
Position
1:complement(23428563..23484631)
AA seq 903 aa
MPEQFSVAEFLAVTAEDLSSPAGAAAFAAKMPRYRGAALAREEILEGDQAILQRIKKAVR
AIHSSGLGHVENEEQYREAVESLGNSHLSQNSHELSTGFLNLAVFTREVAALFKNLIQNL
NNIVSFPLDSLMKGQLRDGRQDSKKQLEKAWKDYEAKMAKLEKERDRARVTGGIPGEVAQ
DMQRERRIFQLHMCEYLLKAGESQMKQGPDFLQSLIKFFHAQHNFFQDGWKAAQSLFPFI
EKLAASVHALHQAQEDELQKLTQLRDSLRGTLQLESREEHLSRKNSGCGYSIHQHQGNKQ
FGTEKVGFLYKKSDGIRRVWQKRKCGVKYGCLTISHSTINRPPVKLTLLTCQVRPNPEEK
KCFDLVTHNRTYHFQAEDEHECEAWVSVLQNSKDEALSSAFLGEPSAGPGSWGSAGHDGE
PHDLTKLLIAEVKSRPGNSQCCDCGAADPTWLSTNLGVLTCIQCSGVHRELGVRFSRMQS
LTLDLLGPSELLLALNMGNTSFNEVMEAQLPSHGGPKPSAESDMGTRRDYIMAKYVEHRF
ARRCTPEPQRLWTAICNRDLLSVLEAFANGQDFGQPLPGPDAQAPEELVLHLAVKVANQA
SLPLVDFIIQNGGHLDAKAADGNTALHYAALYNQPDCLKLLLKGRALVGTVNEAGETALD
IARKKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAH
WASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCARHASGDRSEVS
SLSSEAPETPESLGSPASSSSLMSPLEPGDPSQAPPNSEEGLREPPGTSRPSLTSGTTPS
EMYLPVRFSSESTRSYRRGARSPEDGPSARQPLPRRNVPVGITEGDGSRTGSLPASSVQL
LQD
NT seq 2712 nt   +upstreamnt  +downstreamnt
atgccggagcagttcagcgtcgccgagttcctggccgtcaccgcggaggacctcagctcc
ccggctggggccgccgccttcgccgccaagatgccccggtaccgaggggcggcgctggcg
cgggaggagatcttggaaggagaccaagccatcctgcagagaataaagaaggctgtgcgg
gcaatccatagctccggccttggccatgtggagaatgaagagcagtaccgagaggccgtg
gaatccttaggcaacagccacctgtcccagaacagccatgagctgtccacaggcttccta
aacttggccgtgttcacccgcgaggttgctgcgctcttcaagaacctgattcagaacttg
aacaacattgtctctttccccctggacagtctgatgaaggggcagctgagggacggtcga
caggattccaaaaaacagctggagaaggcatggaaggactatgaagccaaaatggccaag
ctggagaaggagcgcgatcgggccagggtgacaggagggatccctggggaggtggcccag
gacatgcagagagagcggcgcatcttccagctgcacatgtgtgagtatctgctcaaagcc
ggggagagccagatgaagcaaggtcctgacttccttcagagcctcatcaagttcttccac
gcccagcacaactttttccaagatggctggaaggctgcccagagcctgttccccttcatc
gagaagctggcggcctcagtacatgcactccatcaggcccaggaggacgagctacagaag
ctgacccagctccgggactccctccgagggacactgcagcttgagagcagagaggaacac
ctgagccggaagaactcaggatgtggctatagcatccaccagcaccaaggcaacaagcag
tttgggacggagaaagtgggctttctatacaagaaaagtgacggaattcgaagagtctgg
cagaaaaggaagtgtggagtcaagtatggctgcctgaccatctcacacagcacgataaac
cggcccccggtgaagctgaccctgctgacgtgccaagtgaggccaaaccctgaggagaaa
aagtgcttcgacctggtgacccacaaccggacgtaccactttcaggcagaggacgagcac
gagtgtgaggcgtgggtgtcagtgttgcagaacagcaaggacgaagccctgagcagcgcc
ttcctcggggagcccagcgctggcccggggtcctgggggtccgccggccatgatggggag
ccgcacgacctcacaaagctgctcatcgcggaggtgaagagcaggcctgggaatagccag
tgctgcgactgcggggctgcagaccccacgtggctcagcaccaacctgggcgtgctcacc
tgcatccagtgctcgggcgtccaccgcgaactgggcgtgcgcttttcgcgcatgcagtca
ctcaccttggacctgctgggcccctccgagttgttgctggccttgaacatgggaaacacg
agcttcaatgaggtcatggaggcccagctaccctcacacggcggccctaaaccctcagct
gagagtgacatgggcacccgcagggactacattatggccaagtatgtggagcataggttt
gcacgccggtgcacacctgagcctcagcgactctggacagccatttgcaacagggacctc
ctgtcggtactggaggcctttgccaatgggcaggactttggacagccgctgccagggcct
gatgcacaggcacctgaagaactcgtcttgcatttggctgtcaaagtcgccaaccaggct
tccctgcctctggtggatttcatcatccagaacggtggtcacctggatgccaaggctgct
gacgggaacacggctctgcactacgcagcactctacaaccagcccgactgcctcaagctg
ctgctgaaggggagagctttggttggcacagtaaatgaagcaggcgagacagctctggac
atagccaggaagaagcaccacaaggagtgtgaggagctgctggagcaggcccaggcgggg
acctttgccttccctctacatgtggactactcctgggtaatttccacagagcctggctct
gacagtgaggaggatgaggaagagaagcgctgcttgctgaagctcccggcccaggctcac
tgggccagtgggaggctggacatcagcaacaagacctatgagactgtcgccagcctggga
gcagccacccctcagggcgagagtgaggactgtcccccgcccttgccagtcaaaaactct
tctcggactttggtccaagggtgtgcaagacatgccagtggagatcgttctgaagtctcc
agcctgagttcagaggcccctgagacccctgagagcctgggcagtccagcctcctcctcc
agtctgatgagccccttggaacctggggatcccagccaagccccacccaactctgaagag
ggcctccgagagcccccaggcacctccagacccagcctgacatccgggaccaccccttcg
gagatgtacctccccgtcagattcagctccgagagcactcgctcctatcggcggggggcg
cggagccctgaagatggtccctcagccaggcagcctctgcccagaaggaacgtgccggtt
ggcatcactgaaggagatggctcaaggactgggagtctcccagcaagttctgtgcaactt
ttgcaagactag

KEGG   Homo sapiens (human): 55738
Entry
55738             CDS       T01001                                 
Symbol
ARFGAP1, ARF1GAP, HRIHFB2281
Name
(RefSeq) ADP ribosylation factor GTPase activating protein 1
  KO
K12492  ADP-ribosylation factor GTPase-activating protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    55738 (ARFGAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55738 (ARFGAP1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    55738 (ARFGAP1)
SSDB
Motif
Pfam: ArfGap Ribosomal_L37ae zf-piccolo
Other DBs
NCBI-GeneID: 55738
NCBI-ProteinID: NP_060679
OMIM: 608377
HGNC: 15852
Ensembl: ENSG00000101199
Pharos: Q8N6T3(Tbio)
UniProt: Q8N6T3 Q53F62
Structure
LinkDB
Position
20:63272813..63289790
AA seq 406 aa
MASPRTRKVLKEVRVQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVR
SVTMDKWKDIELEKMKAGGNAKFREFLESQEDYDPCWSLQEKYNSRAAALFRDKVVALAE
GREWSLESSPAQNWTPPQPRTLPSMVHRVSGQPQSVTASSDKAFEDWLNDDLGSYQGAQG
NRYVGFGNTPPPQKKEDDFLNNAMSSLYSGWSSFTTGASRFASAAKEGATKFGSQASQKA
SELGHSLNENVLKPAQEKVKEGKIFDDVSSGVSQLASKVQGVGSKGWRDVTTFFSGKAEG
PLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWTCADTSTERRS
SDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWDNQNW
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggccagcccaagaaccaggaaggttcttaaagaagtcagggtgcaggatgagaacaac
gtttgttttgagtgtggcgcgttcaatcctcagtgggtcagtgtgacctacggcatctgg
atctgcctggagtgctcggggagacaccgcgggcttggggttcacctcagctttgtgcgc
tctgttactatggacaagtggaaggacattgagcttgagaagatgaaagctggtgggaat
gctaagttccgagagttcctggagtctcaggaggattacgatccttgctggtccttgcag
gagaagtacaacagcagagccgcggccctctttagggataaggtggtcgctctggccgaa
ggcagagagtggtctctggagtcatcacctgcccagaactggaccccacctcagcccagg
acgctgccgtccatggtgcaccgagtctctggccagccgcagagtgtgaccgcctcctcg
gacaaggcttttgaagactggctgaatgatgacctcggctcctatcaaggggcccagggg
aatcgctacgtggggtttgggaacacgccaccgcctcagaagaaagaagatgacttcctc
aacaacgccatgtcctccctgtactcgggctggagcagcttcaccactggagccagccgg
tttgcctcggcagccaaggagggcgctacaaagtttggatcccaagcgagtcagaaggcg
tccgagctgggccacagcctgaacgagaacgtcctcaagcctgcgcaggagaaggtgaag
gagggaaagatttttgatgatgtctccagtggggtctctcagttggcgtccaaggtccag
ggagtcggtagtaagggatggcgggacgtcaccacctttttttcggggaaagcagagggc
cccttggacagcccctcggagggccacagttatcagaacagcggtctggaccacttccaa
aacagcaacatagaccagagcttctgggagacctttggaagtgctgagcccaccaagacc
cgcaagtccccgagcagcgacagctggacgtgcgcggacacctccaccgagaggaggagc
tcggacagctgggaggtgtggggctcggcctccaccaacaggaacagcaacagcgacggc
ggggagggcggggagggcaccaagaaggcagtgccgccggccgtgcccactgatgatggc
tgggacaaccagaactggtag

KEGG   Homo sapiens (human): 60682
Entry
60682             CDS       T01001                                 
Symbol
SMAP1, SMAP-1
Name
(RefSeq) small ArfGAP 1
  KO
K12486  stromal membrane-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    60682 (SMAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    60682 (SMAP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    60682 (SMAP1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    60682 (SMAP1)
SSDB
Motif
Pfam: ArfGap EMC3_TMCO1 DUF3824 DUF2027
Other DBs
NCBI-GeneID: 60682
NCBI-ProteinID: NP_001037770
OMIM: 611372
HGNC: 19651
Ensembl: ENSG00000112305
Pharos: Q8IYB5(Tbio)
UniProt: Q8IYB5
Structure
LinkDB
Position
6:70667883..70862015
AA seq 467 aa
MATRSCREKAQKLNEQHQLILSKLLREEDNKYCADCEAKGPRWASWNIGVFICIRCAGIH
RNLGVHISRVKSVNLDQWTAEQIQCMQDMGNTKARLLYEANLPENFRRPQTDQAVEFFIR
DKYEKKKYYDKNAIAITNISSSDAPLQPLVSSPSLQAAVDKNKLEKEKEKKKEEKKREKE
PEKPAKPLTAEKLQKKDQQLEPKKSTSPKKAAEPTVDLLGLDGPAVAPVTNGNTTVPPLN
DDLDIFGPMISNPLPATVMPPAQGTPSAPAAATLSTVTSGDLDLFTEQTTKSEEVAKKQL
SKDSILSLYGTGTIQQQSTPGVFMGPTNIPFTSQAPAAFQGFPSMGVPVPAAPGLIGNVM
GQSPSMMVGMPMPNGFMGNAQTGVMPLPQNVVGPQGGMVGQMGAPQSKFGLPQAQQPQWS
LSQMNQQMAGMSISSATPTAGFGQPSSTTAGWSGSSSGQTLSTQLWK
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggcgacgcgctcctgtcgggagaaggctcagaagctgaacgagcagcaccagctcatc
ctatccaagcttctgagggaggaggacaacaagtactgcgccgactgcgaggccaaaggt
cctcgatgggcttcctggaatattggtgtgtttatttgcatcagatgtgctggaattcat
agaaatcttggggttcatatatccagggtcaaatcagtcaacctagaccaatggacagca
gaacagatacagtgcatgcaagatatgggaaatactaaagcaagactactctatgaagcc
aatcttccagagaactttcgaagaccacagacagatcaagcagtggaatttttcatcaga
gataaatatgaaaagaagaaatactacgataaaaatgccatagctattacaaatatttcc
tcctctgatgctcctcttcagcctttggtatcctctccttctctgcaagctgctgttgac
aaaaataaattggagaaagaaaaggaaaaaaaaaaggaagagaaaaagagagaaaaggag
ccagaaaagccggcaaaaccacttacagctgaaaagctgcagaagaaagatcagcaactg
gagcctaaaaaaagtaccagccctaaaaaagctgcggagcccactgtggatcttttagga
cttgatggccctgctgtggcaccagtgaccaacgggaacacaacggtgccacccctgaac
gatgatctggacatctttggaccgatgatttctaatcccttacctgcaactgtcatgccc
ccagctcaggggacaccctctgcaccagcagctgcaaccctgtctacagtaacatctggg
gatctagatttattcactgagcaaactacaaaatcagaagaagtggcaaagaaacaactt
tccaaagactccatcttatctctgtatggcacaggaaccattcaacagcaaagtactcct
ggtgtatttatgggacccacaaatataccatttacctcacaagcaccagctgcatttcag
ggctttccatcgatgggcgtgcctgtgcctgcagctcctggccttataggaaatgtgatg
ggacagagtccaagcatgatggtgggcatgcccatgcccaatgggtttatgggaaatgca
caaactggtgtgatgccacttcctcagaacgttgttggcccccaaggaggaatggtggga
caaatgggtgcaccccagagtaagtttggcctgccgcaagctcagcagccccagtggagc
ctctcacagatgaatcagcagatggctggcatgagtatcagtagtgcaacccctactgca
ggttttggccagccctccagcacaacagcaggatggtctggaagctcatcaggtcagact
ctcagcacacaactgtggaaatga

KEGG   Homo sapiens (human): 642517
Entry
642517            CDS       T01001                                 
Symbol
AGAP9, AGAP-9, CTGLF6, bA301J7.2
Name
(RefSeq) ArfGAP with GTPase domain, ankyrin repeat and PH domain 9
  KO
K12491  Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1/3/4/5/6/9/11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    642517 (AGAP9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    642517 (AGAP9)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    642517 (AGAP9)
SSDB
Motif
Pfam: ArfGap PH PH_11 PH_6 PH_8 Ank_4 Ank Ank_3 Ank_2 PH_4
Other DBs
NCBI-GeneID: 642517
NCBI-ProteinID: NP_001177739
HGNC: 23463
Ensembl: ENSG00000204172
Pharos: Q5VTM2(Tdark)
UniProt: Q5VTM2
LinkDB
Position
10:complement(47501854..47523638)
AA seq 658 aa
MGNILTCRVHPSVSLEFDQQQGSVCPSESEIYEAGAEDRMAGAPMAAAVQPAEVTVEVGE
DLHMHQVRDREMPEALEFNLSANPEASTIFQRNSQTDALEFNSSANPEASTIFQRNSQTD
VVEIRRSNCTNHVSTERFSQQYSSCSTIFLDDSTAIQHYLTMTIISVTLEIPHHITQRDA
DRSLSIPDEQLHSFAVSTVHIMKKRNGGGSLNNYSSSIPPTPSTSQEDPQFSVPPTANTP
TPVCKRSMRWSNLFTSEKGSDPDKERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTW
KKKYVTLCSNGVLTYYSSLGDYMKNIHKKEIDLRTSTIKVPGKWPSLATSACAPISSSKS
NGLSKDMDTGLGDSICFSPGISSTTSPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQT
WHFEATTYEERDAWVQAIQSQILASLQSCKSSKSKSQLTSQSEAMALQSIQNMRGNAHCV
DCETQNPKWASLNLGVLMCIECSGIHRSFGTRLSRVRSLELDDWPVELRKVMSSIGNELA
NSIWEGSSQGQTKPSIKSTREEKEWWIRSKYEEKLFLAPLPCTELSLGQQLLRATTDEDL
QTAILLLAHGSREEVNETCGEGDGCTALHLACRKGNVVLEQLLTGWTSWPEMPTGTQR
NT seq 1977 nt   +upstreamnt  +downstreamnt
atggggaacatactgacctgtcgtgtgcaccctagcgtcagcctcgagtttgaccagcag
caggggtcggtgtgtccctctgaatctgagatctatgaggcaggagctgaggacaggatg
gcaggagcgcccatggctgctgctgtacagcctgctgaggtgactgttgaagttggtgag
gacctccacatgcaccaggttcgtgaccgggagatgcctgaagctttggagtttaacctt
tctgccaatccagaggcaagcacaatattccagaggaactctcaaacagatgctttggag
tttaactcttctgccaatccagaggcaagcacaatattccagaggaactctcaaacagat
gttgtagaaataagaagaagcaactgtacaaaccatgtatctactgagcgtttcagtcaa
caatacagctcgtgttcgacaatattccttgatgacagcacagccatccagcattatctt
acaatgacaataatatctgtgaccttggagatacctcatcatatcacacaaagagatgca
gatagatctttgagcatacctgatgaacagttacactcatttgcggtttccaccgtgcac
attatgaagaaaagaaatggaggtgggagtttaaataactattcctcctccattccaccg
actcccagcaccagccaggaggaccctcagttcagtgttcctcccactgccaacacaccc
acccccgtttgcaagcggtccatgcgctggtccaacctgtttacatctgagaaagggagt
gacccagacaaagagaggaaagccccggagaatcatgctgacaccatcgggagcggcaga
gccatccccattaaacagggcatgctcttaaagcgaagtggaaaatggctgaagacatgg
aaaaagaaatacgtcaccctgtgttccaatggcgtgctcacctattattcaagcttaggt
gattatatgaagaatattcataaaaaagagattgaccttcggacatctaccatcaaagtc
ccaggaaagtggccatccctagccacatcagcctgtgcacccatctccagctctaaaagc
aatggcctatccaaggacatggacaccgggctgggtgactccatatgcttcagccccggt
atctccagcaccaccagccccaagctcaacccgcccccctctcctcatgccaataaaaag
aaacacctaaagaagaaaagcaccaacaactttatgattgtgtctgccactggccaaacg
tggcactttgaagccacgacgtatgaggagcgggatgcctgggtccaagccatccagagc
cagatcctggccagcctgcagtcatgcaagagcagtaaaagcaagtcccagctgaccagc
cagagtgaggccatggccctgcagtcgatccaaaacatgcgtgggaacgcccactgtgtg
gactgtgagacccagaatcctaagtgggccagtttgaacttgggagtcctcatgtgtatt
gaatgctcaggtatccaccgcagttttggcacccgcctttcccgtgtgcgatctctggag
ctggatgactggccagttgagctcaggaaggttatgtcatctattggcaatgagctagcc
aacagcatctgggaagggagcagccaggggcagacaaaaccctcaataaagtccacgagg
gaagagaaggaatggtggatccgttccaaatatgaggagaagctctttctggccccacta
ccctgcactgagctgtccctgggccagcagctgctgcgggccaccactgatgaggacctg
cagacagccatcctgctgctggcacatggctcccgtgaggaggtgaacgagacctgtggg
gagggagacggctgcacggcactccatctggcctgccgcaaggggaatgtggtcctggag
cagctcctgacggggtggacgtcatggcccgagatgcccacgggaacacagcgctga

KEGG   Homo sapiens (human): 64411
Entry
64411             CDS       T01001                                 
Symbol
ARAP3, CENTD3, DRAG1
Name
(RefSeq) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 3
  KO
K12490  Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04024  cAMP signaling pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    64411 (ARAP3)
   04024 cAMP signaling pathway
    64411 (ARAP3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    64411 (ARAP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    64411 (ARAP3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    64411 (ARAP3)
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    64411 (ARAP3)
SSDB
Motif
Pfam: RhoGAP PH ArfGap RA SAM_2 SAM_1 PH_8 PH_3 PH_6 PH_2
Other DBs
NCBI-GeneID: 64411
NCBI-ProteinID: NP_071926
OMIM: 606647
HGNC: 24097
Ensembl: ENSG00000120318
Pharos: Q8WWN8(Tbio)
UniProt: Q8WWN8 Q05CH1 Q9H7C1
Structure
LinkDB
Position
5:complement(141653402..141682230)
AA seq 1544 aa
MAAPQDLDIAVWLATVHLEQYADTFRRHGLATAGAARGLGHEELKQLGISATGHRKRILR
LLQTGTEEGSLDPKSDSAMEPSPSPAPQAQPPKPVPKPRTVFGGLSGPATTQRPGLSPAL
GGPGVSRSPEPSPRPPPLPTSSSEQSSALNTVEMMPNSIYFGLDSRGRAQAAQDKAPDSS
QISAPTPALRPTTGTVHIMDPGCLYYGVQPVGTPGAPDRRESRGVCQGRAEHRLSRQDLE
AREDAGYASLELPGDSTLLSPTLETEETSDDLISPYASFSFTADRLTPLLSGWLDKLSPQ
GNYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSSKDNKFQVITGQRVFVFR
TESEAQRDMWCSTLQSCLKEQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPGELA
LYKSEQAFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSFTAESGGARQSWAAALQE
AVTETLSDYEVAEKIWSNRANRQCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGISK
VQSLKLDTSVWSNEIVQLFIVLGNDRANRFWAGTLPPGEGLHPDATPGPRGEFISRKYRL
GLFRKPHPQYPDHSQLLQALCAAVARPNLLKNMTQLLCVEAFEGEEPWFPPAPDGSCPGL
LPSDPSPGVYNEVVVRATYSGFLYCSPVSNKAGPSPPRRGRDAPPRLWCVLGAALEMFAS
ENSPEPLSLIQPQDIVCLGVSPPPTDPGDRFPFSFELILAGGRIQHFGTDGADSLEAWTS
AVGKWFSPLSCHQLLGPGLLRLGRLWLRSPSHTAPAPGLWLSGFGLLRGDHLFLCSAPGP
GPPAPEDMVHLRRLQEISVVSAADTPDKKEHLVLVETGRTLYLQGEGRLDFTAWNAAIGG
AAGGGGTGLQEQQMSRGDIPIIVDACISFVTQHGLRLEGVYRKGGARARSLRLLAEFRRD
ARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKDVI
GCLPRVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRVLQEL
IDGYISVFDIDSDQVAQIDLEVSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVTLKVSP
TLTAEELTNQVLEMRGTAAGMDLWVTFEIREHGELERPLHPKEKVLEQALQWCQLPEPCS
ASLLLKKVPLAQAGCLFTGIRRESPRVGLLRCREEPPRLLGSRFQERFFLLRGRCLLLLK
EKKSSKPEREWPLEGAKVYLGIRKKLKPPTPWGFTLILEKMHLYLSCTDEDEMWDWTTSI
LKAQHDDQQPVVLRRHSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTLS
MFFPMKSSQGSVEEQEELEEPVYEEPVYEEVGAFPELIQDTSTSFSTTREWTVKPENPLT
SQKSLDQPFLSKSSTLGQEERPPEPPPGPPSKSSPQARGSLEEQLLQELSSLILRKGETT
AGLGSPSQPSSPQSPSPTGLPTQTPGFPTQPPCTSSPPSSQPLT
NT seq 4635 nt   +upstreamnt  +downstreamnt
atggctgcccctcaggacctggacatcgctgtgtggctggccacggtgcacctggagcag
tatgcagacacgttccgacggcatggcctggctacagcaggtgcagcccggggcctgggc
cacgaggagttgaagcagttgggcatcagcgccacagggcaccggaaacgcattctacgc
ctgctacagacaggcaccgaagagggctccctggatcccaaatcagatagtgccatggaa
ccatcccccagcccagccccgcaagcccagccccctaagcccgtgccgaagcccaggacc
gtgtttggtggactcagtggccctgccaccactcagagacctgggctgagcccagccctc
gggggaccaggagtgtccaggagcccagagcccagcccaaggcctcctcctctccccact
tcctcctctgagcagtcttcagccctaaatactgtggagatgatgcctaattccatctac
ttcggcctggactcaagaggcagggcacaggcagctcaggacaaggccccagacagctcc
caaatctctgcccccacccctgccctcaggcccacaacaggcacagtgcacatcatggat
cctggttgcctgtactatggtgtccaacctgtggggactccaggagcccccgacagaaga
gagagcagaggtgtttgtcagggcagggctgaacacaggctcagcagacaggatctggag
gcacgggaggatgctggctatgccagccttgagctacctggagactccaccctcttatcg
cccaccctggaaacagaggagaccagtgatgacctcatttcaccctatgccagcttctcc
ttcacggcagaccgcctcacgcccctgctcagtggctggctagacaagctctcccctcag
ggaaactatgtcttccagagacgctttgtgcagttcaatgggaggagtctgatgtacttt
ggcagtgacaaggaccccttccctaagggtgtgatacctttgactgccattgagatgacc
cgcagcagcaaggacaacaagttccaggtcatcaccggccagagggtgttcgtgttccgc
acagagagcgaggctcagcgggacatgtggtgctccacgctgcagtcctgtctgaaggag
cagcgcctcctgggccacccccggcccccccaaccaccccgacccctccgcacgggcatg
ctggagctgcgtggacacaaggccaaggtgtttgctgccttgagccctggagagctggca
ctgtacaagagtgagcaggccttctctctgggcatcgggatctgcttcatcgaactgcag
ggctgcagcgtccgggagaccaagagtcgaagctttgacctgctcacaccccatcgctgc
ttcagcttcacagccgagtctgggggtgctcggcagagctgggcggccgctctgcaggaa
gcagtaaccgagaccctgtctgactacgaggtggctgagaagatctggtctaatcgggcc
aaccggcagtgtgcggactgtgggtcctcccgcccagattgggctgctgtcaatttgggg
gtggtcatctgcaagcagtgtgcaggtcagcaccgggccctgggttctgggatctccaag
gtgcagagcctgaagctggacacgagtgtctggagtaatgagatagtacagttattcatt
gtcctgggaaatgatcgtgccaaccgcttctgggcagggaccctacccccaggtgaggga
ctacatccagatgcgacccctggcccccggggagagttcatctcccgaaagtaccgtctg
ggtctcttccggaagccccaccctcagtacccagatcatagccagcttctccaggcactg
tgtgcagctgtggcaagacccaacctgctgaagaacatgacccagctcctctgtgttgag
gcctttgaaggcgaggagccctggttccccccagcccctgatggcagctgccctggcctc
ttgccctcagacccctcccctggtgtgtacaatgaggtggtggtgcgtgctacttacagc
ggcttcctgtactgcagtcccgtcagcaacaaagctggaccctcaccccctcgcaggggc
cgggatgctcccccgcgcctttggtgtgtgctgggagcagctctggaaatgtttgcatcg
gaaaacagccctgaacccctcagcctcatacagccccaggatattgtatgtctgggtgtg
agccccccacccactgacccaggtgacaggttccccttttcctttgagctcatcctcgct
ggggggaggatccagcattttggcacagatggagctgacagtctggaggcctggactagt
gctgtgggcaagtggttctccccgctgagctgccaccagctgctgggccccgggctgctg
cggctgggccgcctatggctgcggtccccctcccatacagccccggcccctggtctctgg
ctgtcagggtttggcctccttcgtggtgaccacctcttcctgtgctcagcgccgggccca
ggccccccagcccctgaggacatggtgcatctgcggcggctacaggagatcagtgtggtt
tctgcagctgacaccccagataagaaagagcatttggtcctggtggagacaggaaggacc
ctgtatctgcaaggagagggccggctggacttcacggcatggaacgcagccattgggggc
gcggctggtgggggcggcacagggctgcaggagcagcagatgagccggggtgacatcccc
atcatcgtggatgcctgcatcagttttgttacccagcatgggctccggctggaaggtgta
taccggaaagggggcgctcgtgcccgcagcctgagactcctggctgagttccgtcgggat
gcccggtcggtgaagctccgaccaggggagcactttgtggaggatgtcactgacacactc
aaacgcttctttcgtgagctcgatgaccctgtgacctctgcacggttgctgcctcgctgg
agggaggctgctgagctgccccagaagaatcagcgcctggagaaatataaagatgtgatt
ggctgcctgccgcgggtcaaccgccgcacactggccaccctcattgggcatctctatcgg
gtgcagaaatgtgcggctctaaaccagatgtgcacgcggaacttggctctgctgtttgca
cccagcgtgttccagacggatgggcgaggggagcacgaggtgcgagtgctgcaagagctc
attgatggctacatctctgtctttgatatcgattctgaccaggtagctcagattgacttg
gaggtcagtcttatcaccacctggaaggacgtgcagctgtctcaggctggagacctcatc
atggaagtttatatagagcagcagctcccagacaactgtgtcaccctgaaggtgtcccca
accctgactgctgaggagctgactaaccaggtactggagatgcgggggacagcagctggg
atggacttgtgggtgacttttgagattcgcgagcatggggagctggagcggccactgcat
cccaaggaaaaggtcttagagcaggctttacaatggtgccagctcccagagccctgctca
gcttccctgctcttgaaaaaagtccccctggcccaagctggctgcctcttcacaggtatc
cgacgtgagagcccacgggtggggctgttgcggtgtcgtgaggagccacctcgcttgctg
ggaagccgcttccaggagaggttctttctgctgcgtggccgctgcctgctgctgctcaag
gagaagaaaagctctaaaccagaacgggagtggcctttggaaggtgccaaggtctacctg
ggaatccgcaagaagttaaagcccccaacaccgtggggcttcacattgatactagagaag
atgcacctctacttgtcctgcactgacgaggatgaaatgtgggattggaccaccagcatc
cttaaagcccagcacgatgaccagcagccagtggtcttacgacgccattcctcctctgac
cttgcccgtcagaagtttggcactatgcctttgctgcctatccgtggggatgacagtgga
gccaccctcctctctgccaatcagaccctgcggcgactacacaaccggaggaccctgtcc
atgttctttccaatgaagtcatcccaggggtctgtggaggagcaagaggagctggaggag
cctgtgtacgaggagccagtgtatgaggaagtaggggccttccctgagttgatccaggac
acttctacctccttctccaccacacgggagtggacagtgaagccagagaaccccctcacc
agccagaagtcattggatcaaccctttctctccaagtcaagcacccttggccaggaggag
aggccacctgagccccctccaggccccccttcaaagagcagtccccaggcacgggggtcc
ctagaggaacagctgctccaggagctcagcagcctcatcctgaggaaaggagagaccact
gcaggcctgggaagtccttcccagccatccagcccccaatcccccagccccactggcctt
ccaacacagacacctggcttccccacccaacccccatgcacttccagtccaccctccagc
cagcccctcacatga

KEGG   Homo sapiens (human): 64744
Entry
64744             CDS       T01001                                 
Symbol
SMAP2, SMAP1L
Name
(RefSeq) small ArfGAP2
  KO
K12486  stromal membrane-associated protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    64744 (SMAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    64744 (SMAP2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    64744 (SMAP2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    64744 (SMAP2)
SSDB
Motif
Pfam: ArfGap
Other DBs
NCBI-GeneID: 64744
NCBI-ProteinID: NP_073570
OMIM: 616916
HGNC: 25082
Ensembl: ENSG00000084070
Pharos: Q8WU79(Tbio)
UniProt: Q8WU79
Structure
LinkDB
Position
1:40344834..40423326
AA seq 429 aa
MTGKSVKDVDRYQAVLANLLLEEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGV
HISRVKSVNLDQWTQEQIQCMQEMGNGKANRLYEAYLPETFRRPQIDPAVEGFIRDKYEK
KKYMDRSLDINAFRKEKDDKWKRGSEPVPEKKLEPVVFEKVKMPQKKEDPQLPRKSSPKS
TAPVMDLLGLDAPVACSIANSKTSNTLEKDLDLLASVPSPSSSGSRKVVGSMPTAGSAGS
VPENLNLFPEPGSKSEEIGKKQLSKDSILSLYGSQTPQMPTQAMFMAPAQMAYPTAYPSF
PGVTPPNSIMGSMMPPPVGMVAQPGASGMVAPMAMPAGYMGGMQASMMGVPNGMMTTQQA
GYMAGMAAMPQTVYGVQPAQQLQWNLTQMTQQMAGMNFYGANGMMNYGQSMSGGNGQAAN
QTLSPQMWK
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgacaggcaagtcggtgaaggacgtggatcggtaccaggctgtcctggccaacctgctg
ctggaggaggataacaagttttgtgcagattgccagtctaaagggccgcgatgggcctct
tggaacattggtgtgttcatctgcattcgatgtgctggaatccacaggaatctgggggtg
cacatatccagggtaaagtcagttaacctcgaccagtggactcaagaacagattcagtgc
atgcaagagatgggaaatggaaaggcaaaccgactttatgaagcctatcttcctgagacc
tttcggcgacctcagatagacccagctgttgaaggatttattcgagacaaatatgagaag
aagaaatacatggaccgaagtctggacatcaatgcctttaggaaagaaaaagatgacaag
tggaaaagagggagcgaaccagttccagaaaaaaaattggaacctgttgtttttgagaag
gtgaaaatgccacagaaaaaagaagacccacagctacctcggaaaagctccccgaaatcc
acagcgcctgtcatggatttgttgggccttgatgctcctgtggcctgctccattgcaaat
agtaagaccagcaataccctagagaaggatttagatctgttggcctctgttccatcccct
tcttcttccggttccagaaaggttgtaggttccatgccaactgcagggagtgccggctct
gttcctgaaaatctgaacctgtttccggagccagggagcaaatcagaagaaataggcaag
aaacagctctctaaagactccattctttcactgtatggatcccagacgcctcaaatgcct
actcaagcaatgttcatggctcccgctcagatggcatatcccacagcctaccccagcttc
cccggggttacacctcctaacagcataatggggagcatgatgcctccaccagtaggcatg
gttgctcagccaggagcttctgggatggttgcccccatggccatgcctgcaggctatatg
ggtggcatgcaggcatcaatgatgggtgtgccgaatggaatgatgaccacccagcaggct
ggctacatggcaggcatggcagctatgccccagactgtgtatggggtccagccagctcag
cagctgcaatggaaccttactcagatgacccagcagatggctgggatgaacttctatgga
gccaatggcatgatgaactatggacagtcaatgagtggcggaaatggacaggcagcaaat
cagactctcagtcctcagatgtggaaataa

KEGG   Homo sapiens (human): 729092
Entry
729092            CDS       T01001                                 
Symbol
AGAP5, CTGLF2
Name
(RefSeq) ArfGAP with GTPase domain, ankyrin repeat and PH domain 5
  KO
K12491  Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1/3/4/5/6/9/11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    729092 (AGAP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    729092 (AGAP5)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    729092 (AGAP5)
SSDB
Motif
Pfam: ArfGap PH Ank_2 Ank Ank_5 Ank_4 PH_11 Ank_3 PH_6 PH_8 PH_4
Other DBs
NCBI-GeneID: 729092
NCBI-ProteinID: NP_001137472
HGNC: 23467
Ensembl: ENSG00000172650
Pharos: A6NIR3(Tdark)
UniProt: A6NIR3
LinkDB
Position
10:complement(73674295..73698109)
AA seq 686 aa
MGNILTCCVHPSVSLEFDQQQGSVCPSESEIYEAGAGDRMAGAPMAAAVQPAEVTVEVGE
DLHMHHIRDQEMPEALEFSLSANPEASTIFQRNSQTDALEFNPSANPEASTIFQRNSQTD
VVEIRRSNCTNHVSTERFSQQYSSCSTIFLDDSTASQHYLTMTIISVTLEIPHHITQRDA
DRSLSIPDEQLHSFAVSTVHITKNRNGGGSLNNYSSSIPSTPSTSQEDPQFSVPPTANTP
TPVCKRSMRWSNLFTSEKGSHPDKERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTW
KKKYVTLCSNGVLTYYSSLGDYMKNIHKKEIDLRTSTIKVPGKWPSLATSACAPISSSKS
NGLSKDMDTGLGDSICFSPSISSTTSPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQT
WHFEATTYEERDAWVQAIQSQILASLQSCESSKSKSQLTSQSEAMALQSIQNMRGNAHCV
DYETQNPKWASLNLGVLMCIECSGIHRSLGTRLSRVRSLELDDWPVELRKVMSSIGNDLA
NSIWEGSSQGQTKPSVKSTREEKERWIRSKYEEKLFLAPLPCTELSLGQHLLRATADEDL
QTAILLLAHGSREEVNETCGEGDGCTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTA
LTYARQASSQECINVLLQYGCPDECV
NT seq 2061 nt   +upstreamnt  +downstreamnt
atggggaacatactgacctgttgtgtgcaccctagcgtcagcctcgagtttgaccagcaa
caggggtcggtgtgtccctctgaatctgagatctatgaggcaggagctggggacaggatg
gcaggagcgcccatggctgctgctgtgcagcctgctgaggtgaccgttgaagttggtgag
gacctccacatgcaccacattcgtgaccaggagatgcctgaagctttggagtttagcctt
tctgccaatccagaggcaagcacaatattccagaggaactctcaaacagatgctttggag
tttaacccttctgccaatccagaggcaagcacaatattccagaggaactctcaaacagat
gttgtagaaataagaagaagcaactgtacaaaccatgtatctactgagcgtttcagtcaa
caatacagctcgtgttcgacaatattccttgatgacagcacagccagccagcattatctt
acaatgacaataatatctgtgaccttggagatacctcatcatatcacacaaagagatgca
gatagatctttgagcatacctgatgaacagttacactcatttgcggtttccaccgtgcac
attacgaagaacagaaatggaggtgggagtttaaataactattcctcctccattccatcg
actcccagcaccagccaggaggaccctcagttcagtgttcctcccactgccaacacaccc
acccccgtttgcaagcggtccatgcgctggtccaacctgtttacatctgagaaagggagt
cacccagacaaagagaggaaagccccggagaatcatgctgacaccatcgggagcggcaga
gccatccccattaaacagggcatgctcttaaagcgaagtgggaaatggctgaagacatgg
aaaaagaaatacgtcaccctgtgttccaatggcgtgctcacctattattcaagcttaggt
gattatatgaagaatattcataaaaaagagattgaccttcggacatctaccatcaaagtc
ccaggaaagtggccatccctagccacatcggcctgtgcacccatctccagctctaaaagc
aatggcctatccaaggacatggacaccgggctgggtgactccatatgcttcagccccagt
atctccagcaccaccagccccaagctcaacccgcccccctctcctcatgccaataaaaag
aaacacctaaagaagaaaagcaccaacaactttatgattgtgtctgccactggccaaaca
tggcactttgaagccacgacgtatgaggagcgggatgcctgggtccaagccatccagagc
cagatcctggccagcctgcagtcatgcgagagcagtaaaagcaagtcccagctgaccagc
cagagcgaggccatggccctgcagtcgatccaaaacatgcgtgggaacgcccactgtgtg
gactatgagacccagaatcctaagtgggccagtttgaacttgggagtcctcatgtgtatt
gaatgctcaggaatccaccgcagtcttggcacccgcctttcccgtgtgcgatctctggag
ctggatgactggccagttgagctcaggaaggttatgtcatctattggcaatgacctagcc
aacagcatctgggaagggagcagccaggggcagacaaaaccctcagtaaagtccacgagg
gaagagaaggaacggtggatccgttccaaatatgaggagaagctctttctggccccacta
ccctgcactgagctgtccctgggccagcacctgctgcgggccaccgctgatgaggacctg
cagacagccatcctgctgctggcacatggctcccgtgaggaggtgaacgagacctgtggg
gagggagacggctgcacggcgctccatctggcctgccgcaaggggaatgtggtcctggca
cagctcctgatctggtacggggtggacgtcatggcccgagatgcccacgggaacacagcg
ctgacctacgcccggcaggcctccagccaggagtgcatcaacgtgcttctgcagtacggc
tgccccgacgagtgcgtgtag

KEGG   Homo sapiens (human): 84364
Entry
84364             CDS       T01001                                 
Symbol
ARFGAP2, IRZ, NBLA10535, ZFP289, ZNF289
Name
(RefSeq) ADP ribosylation factor GTPase activating protein 2
  KO
K12493  ADP-ribosylation factor GTPase-activating protein 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    84364 (ARFGAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    84364 (ARFGAP2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    84364 (ARFGAP2)
SSDB
Motif
Pfam: ArfGap
Other DBs
NCBI-GeneID: 84364
NCBI-ProteinID: NP_115765
OMIM: 606908
HGNC: 13504
Ensembl: ENSG00000149182
Pharos: Q8N6H7(Tbio)
UniProt: Q8N6H7
Structure
LinkDB
Position
11:complement(47164301..47176879)
AA seq 521 aa
MAAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHL
SFIRSTELDSNWNWFQLRCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQ
LGSAALARHGTDLWIDNMSSAVPNHSPEKKDSDFFTEHTQPPAWDAPATEPSGTQQPAPS
TESSGLAQPEHGPNTDLLGTSPKASLELKSSIIGKKKPAAAKKGLGAKKGLGAQKVSSQS
FSEIERQAQVAEKLREQQAADAKKQAEESMVASMRLAYQELQIDRKKEEKKLQNLEGKKR
EQAERLGMGLVSRSSVSHSVLSEMQVIEQETPVSAKSSRSQLDLFDDVGTFASGPPKYKD
NPFSLGESFGSRWDTDAAWGMDRVEEKEPEVTISSIRPISERATNRREVESRSSGLESSE
ARQKFAGAKAISSDMFFGREVDAEYEARSRLQQLSGSSAISSSDLFGDMDGAHGAGSVSL
GNVLPTADIAQFKQGVKSVAGKMAVLANGVMNSLQDRYGSY
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggcggcggagccgaacaagaccgaaatccagactctttttaagaggcttcgcgcagtt
ccaaccaacaaggcctgtttcgactgcggcgccaagaatccgagttgggccagcatcacg
tacggtgttttcttgtgcattgactgttccggggtgcaccgctccctgggcgtccatctg
agcttcatcaggtccacagagttggattccaactggaactggttccagctgaggtgtatg
caggtcggcgggaatgccaatgcgacggctttttttcgccaacatggatgcacagccaat
gatgccaacaccaaatataatagccgagctgcccagatgtaccgggagaagatccggcag
ctggggagtgcggccctggctaggcatggcactgatctttggatagacaacatgagtagt
gccgttcctaatcactccccagagaagaaggactctgatttcttcacagaacacactcaa
ccccctgcctgggatgcgccagccactgagccttcagggacccagcagccagccccgtct
acagagagcagtggcctggcacagccggagcatggccccaacacagacctgcttggcacc
tcacccaaagcctcactggaactgaaaagctccatcattggcaagaagaagccagcagca
gctaagaaagggctgggtgccaagaaaggcctaggggcccagaaggtgagcagccagagc
ttcagtgagattgagcggcaggctcaggtggcagagaagctccgtgagcagcaggcagcc
gatgccaagaagcaggcggaggagtccatggtcgcctccatgcgtctggcctaccaggag
ctccagattgatcgtaagaaagaggaaaagaagctacagaatctggaagggaagaagcga
gagcaggcagaaaggttgggcatgggcttggtatcccgaagctctgtctcccactccgtg
ctgtctgagatgcaggtgattgagcaggaaaccccagtgagtgcaaaatcctctcgctcg
cagctggacttgtttgacgatgttggtactttcgcctctggacccccaaagtacaaggac
aatcccttttccttaggggaaagctttggctcccgctgggatacagatgctgcctggggt
atggacagggtagaggagaaggagccagaagtgaccatctcaagcatccggcctatttca
gaaagagccacaaaccggagggaagtggagagccggagctcaggcctcgagtctagtgag
gcgcgtcagaaattcgcaggagccaaagccatctcatctgacatgttctttgggcgggag
gtggatgcagagtatgaggccaggtctcggctgcagcagctctcaggcagcagtgccatc
agctcttcagacctctttggggacatggatggagctcacggagcaggaagtgtatctctg
gggaacgtgctgcctacagcggacattgcccagtttaagcagggtgtcaagtctgtggct
gggaaaatggctgtgctggccaatggtgtgatgaattccttgcaggatcgctacggttcc
tactga

KEGG   Homo sapiens (human): 8853
Entry
8853              CDS       T01001                                 
Symbol
ASAP2, AMAP2, CENTB3, DDEF2, PAG3, PAP, Pap-alpha, SHAG1
Name
(RefSeq) ArfGAP with SH3 domain, ankyrin repeat and PH domain 2
  KO
K12488  Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8853 (ASAP2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    8853 (ASAP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8853 (ASAP2)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Arf GTPases and associated proteins
   Arf GTPase associated proteins
    8853 (ASAP2)
SSDB
Motif
Pfam: ArfGap BAR_3 Ank_2 PH SH3_9 SH3_1 Ank SH3_2 Ank_5 Ank_4 BAR Ank_3 PH_9 PH_13 Sharpin_PH
Other DBs
NCBI-GeneID: 8853
NCBI-ProteinID: NP_003878
OMIM: 603817
HGNC: 2721
Ensembl: ENSG00000151693
Pharos: O43150(Tbio)
UniProt: O43150
LinkDB
Position
2:9206812..9405678
AA seq 1006 aa
MPDQISVSEFVAETHEDYKAPTASSFTTRTAQCRNTVAAIEEALDVDRMVLYKMKKSVKA
INSSGLAHVENEEQYTQALEKFGGNCVCRDDPDLGSAFLKFSVFTKELTALFKNLIQNMN
NIISFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKITKIEKEKKEHAKLHGMIRTEISG
AEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVES
LKPSIETLSTDLHTIKQAQDEERRQLIQLRDILKSALQVEQKEDSQIRQSTAYSLHQPQG
NKEHGTERNGSLYKKSDGIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQVKTNP
EEKKCFDLISHDRTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELT
KEIISEVQRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDV
LGTSELLLAKNIGNAGFNEIMECCLPAEDSVKPNPGSDMNARKDYITAKYIERRYARKKH
ADNAAKLHSLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDETALHLAVRSVDRTS
LHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGETPLDI
AKRLKHEHCEELLTQALSGRFNSHVHVEYEWRLLHEDLDESDDDMDEKLQPSPNRREDRP
ISFYQLGSNQLQSNAVSLARDAANLAKEKQRAFMPSILQNETYGALLSGSPPPAQPAAPS
TTSAPPLPPRNVGKVQTASSANTLWKTNSVSVDGGSRQRSSSDPPAVHPPLPPLRVTSTN
PLTPTPPPPVAKTPSVMEALSQPSKPAPPGISQIRPPPLPPQPPSRLPQKKPAPGADKST
PLTNKGQPRGPVDLSATEALGPLSNAMVLQPPAPMPRKSQATKLKPKRVKALYNCVADNP
DELTFSEGDVIIVDGEEDQEWWIGHIDGDPGRKGAFPVSFVHFIAD
NT seq 3021 nt   +upstreamnt  +downstreamnt
atgccggaccagatctccgtgtcggaattcgtggccgagacccatgaggactacaaggcg
cccacggcctccagcttcaccacccgcacggcgcagtgccggaacactgtggcggccatc
gaggaggctttggacgtggaccggatggttctttacaaaatgaagaaatccgtgaaagca
atcaacagctctgggctggctcacgtggaaaatgaagagcagtacacccaggctctggag
aagtttggcggcaactgtgtatgcagagatgacccagatttaggaagtgcgttcctgaag
ttctcagtgtttacaaaggagttgacagcacttttcaaaaacctgattcagaatatgaac
aacataatctccttccctttggacagtttgctgaagggggacctgaaaggagtgaaaggg
gatctgaaaaagccttttgataaagcttggaaggactatgaaacaaaaataaccaagata
gaaaaggagaaaaaggaacacgccaagctccatgggatgattcggactgaaataagcgga
gcggaaattgccgaagagatggaaaaggagaggcgcttcttccagctacagatgtgcgag
tatctgctgaaggtcaacgaaatcaagattaaaaagggagtagatttacttcagaatctg
atcaaatactttcatgcccaatgcaatttttttcaggatggactcaaagccgtggaaagc
ctcaaaccttccattgaaacgctgtctacggatcttcacacgatcaaacaggcccaggat
gaagaaagaaggcagttgatacagcttcgagatattttgaaatccgcattgcaggttgaa
cagaaagaggactcccaaattcgtcagagcacagcttatagcttacatcagcctcaggga
aacaaggaacatgggaccgagcggaacggcagcctctacaagaagagtgacgggatccga
aaagtgtggcagaaaaggaaatgttcagttaaaaatggttttctgaccatatcccatggt
accgctaaccggcctcctgcaaagctcaacctgctaacctgccaggtgaagaccaaccct
gaggagaagaagtgctttgacctcatttcacatgacagaacttaccactttcaagctgaa
gatgaacaggaatgtcaaatatggatgtctgtgctgcaaaatagcaaagaagaagcttta
aacaatgcatttaagggggatgacaatactggagaaaataacatcgtccaagaactgaca
aaggagatcatctcagaagtgcagaggatgacgggcaatgacgtctgctgtgactgtggg
gcgccagatcctacatggctttccaccaacctgggcatcctgacctgcatcgagtgttcc
ggaatccaccgagagctgggggttcattattccaggatgcagtccctgaccttagatgta
ctgggaacatctgagctgctgctcgccaagaatattgggaatgcaggctttaatgagatc
atggaatgttgcctaccagctgaggactcagtcaaacccaacccaggcagcgacatgaat
gcaagaaaggactacatcacagccaagtacatcgagaggagatacgcaaggaagaagcac
gcggataacgcggcgaagcttcacagtctttgcgaggccgtcaaaacgagagatattttt
ggattgctccaagcttatgctgatggtgtggatcttacggaaaaaatcccactggccaac
ggacatgagccggatgaaacggccctccaccttgcagtcagatccgtggatcgaacctct
cttcacattgtagactttttagttcagaacagtgggaacctggataaacagacagggaaa
ggcagcacagccctgcactactgctgcctgaccgacaatgccgagtgcctcaagttgctc
ctgcgggggaaggcctccatcgagatagcaaacgagtcaggagagactccgctggacatt
gccaagcgcctcaagcacgagcactgtgaggagctgctgacccaagccttatctggaaga
tttaattctcacgttcacgttgaatatgaatggcgactactccacgaagacctggatgaa
agtgatgacgacatggatgagaaattgcagcccagtcccaaccggcgggaagaccggccc
atcagcttctaccagctgggctccaaccagcttcagtctaacgctgtatctttggccaga
gatgctgcaaaccttgccaaggagaagcagagggctttcatgcccagcatcttgcagaat
gagacttacggagccctcctgagtggcagcccacctcccgcccagcctgcagcccccagc
accaccagcgcccccccgcttcctccacggaatgttggcaaagttcagacagcctcctct
gctaacaccctgtggaagacaaactctgtaagtgtggacggtggaagccggcagcgatct
tcgtcagatccgccagctgtccatccaccgctgccccctcttcgcgtgacatctaccaat
cccctgacccccacgccgcccccacccgttgccaagacgcccagcgtaatggaagccttg
agccagccgagcaagcctgccccgcctgggatctcacagatcaggcccccacctctgccc
ccacagccgcccagccgcctcccgcagaagaagcctgcgccgggggctgacaagtccacc
ccactgaccaacaaaggccaaccgagaggacctgtggatctctctgcaacggaagctctg
ggtcctctgtccaatgctatggtcctgcagccccctgcacccatgcctaggaagtcgcag
gcaaccaagttgaagcctaagcgggtgaaagcgctctataactgtgtggctgacaacccc
gatgagctcaccttctccgagggggatgtgatcatcgtggacggggaggaggaccaggag
tggtggattggccacattgatggagatcctggtcgcaaaggcgcattcccggtgtcattt
gtgcactttatcgctgactga

KEGG   Homo sapiens (human): 9744
Entry
9744              CDS       T01001                                 
Symbol
ACAP1, CENTB1
Name
(RefSeq) ArfGAP with coiled-coil, ankyrin repeat and PH domains 1
  KO
K12489  Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9744 (ACAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9744 (ACAP1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9744 (ACAP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    9744 (ACAP1)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    9744 (ACAP1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9744 (ACAP1)
SSDB
Motif
Pfam: BAR_3 ArfGap PH Ank_5 Ank_2 Ank_4 Ank_3 PH_11
Other DBs
NCBI-GeneID: 9744
NCBI-ProteinID: NP_055531
OMIM: 607763
HGNC: 16467
Ensembl: ENSG00000072818
Pharos: Q15027(Tbio)
UniProt: Q15027
Structure
LinkDB
Position
17:7336529..7351477
AA seq 740 aa
MTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTGLLESGRHYLAASRAFV
VGICDLARLGPPEPMMAECLEKFTVSLNHKLDSHAELLDATQHTLQQQIQTLVKEGLRGF
REARRDFWRGAESLEAALTHNAEVPRRRAQEAEEAGAALRTARAGYRGRALDYALQINVI
EDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQ
RHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKK
YKDPVTVVVDDLRLCTVKLCPDSERRFCFEVVSTSKSCLLQADSERLLQLWVSAVQSSIA
SAFSQARLDDSPRGPGQGSGHLAIGSAATLGSGGMARGREPGGVGHVVAQVQSVDGNAQC
CDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLMCELGNVI
INQIYEARVEAMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGRPRGQP
PVPPKPSIRPRPGSLRSKPEPPSEDLGSLHPGALLFRASGHPPSLPTMADALAHGADVNW
VNGGQDNATPLIQATAANSLLACEFLLQNGANVNQADSAGRGPLHHATILGHTGLACLFL
KRGADLGARDSEGRDPLTIAMETANADIVTLLRLAKMREAEAAQGQAGDETYLDIFRDFS
LMASDDPEKLSRRSHDLHTL
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgacggtcaagctggatttcgaggagtgtctcaaggactcaccccgtttccgagcctct
attgagctggtggaagccgaagtgtcagaattggagacccgtctggaaaagctcctgaaa
ctgggcactggtctcctggaaagtgggcgccattaccttgctgccagccgcgccttcgtt
gtcggcatttgtgacctggcccgcctgggtccaccagagcccatgatggcggagtgtctg
gaaaaattcaccgtgagcctgaaccacaagctggacagccatgcggagcttctagatgcc
acccaacacacactgcagcagcagatccagaccctggtcaaggaaggtctgcggggtttc
cgagaggctcgccgggatttctggcggggggctgagagcctggaggctgccctgacccac
aacgcagaggttcccaggcgccgggcccaggaggcagaagaggcaggagctgctttgagg
acggctcgagctgggtaccggggacgggcactggattatgccctgcagatcaacgtgatt
gaggacaagaggaagtttgacatcatggagtttgtgctgcgtttggtggaggcccaggct
acccatttccagcagggccatgaggagctgagccggctgtcccagtatcgaaaggagctg
ggcgcccagttgcaccagctggtcttgaattcagcacgagagaagagggacatggagcag
agacacgtgctgctgaaacagaaggagctgggtggggaggagccagaaccaagcttaaga
gaggggcctggtggcctggtgatggaaggacatctcttcaaacgggccagcaacgcattt
aagacctggagcagacgctggttcaccattcagagcaaccaactggtttaccagaagaag
tacaaggaccctgtgactgtggtggtggatgaccttcgtctctgcacagtgaaactctgc
cctgactcagaaaggcggttctgctttgaggtggtgtccaccagcaagtcctgcctcctc
caggctgactcagagcgcctcctgcagctgtgggtcagtgctgtgcagagcagcattgct
tctgccttcagtcaggctcgccttgatgacagcccccggggtccaggccagggctcagga
cacctggccataggctctgctgccaccctgggctctggtggaatggccaggggaagggag
cctgggggagtcgggcacgtggtggcccaggtccagagtgtggatggcaatgcccagtgc
tgcgactgccgggagccagccccggagtgggccagcatcaaccttggtgtcaccctctgc
attcagtgttccggcatccacaggagccttggtgttcacttctccaaagtccggtctctg
acccttgactcatgggagccagaactagtgaagctcatgtgtgagctgggaaatgtcatc
atcaaccagatctatgaggcccgcgtggaggccatggcagtgaagaaaccagggcccagc
tgctcccggcaggagaaggaggcctggattcacgctaaatacgtggagaagaagttcctg
accaagctgcctgagattcgagggcgaagaggtggccgggggcgcccaagggggcagcct
cctgtgcccccaaagccttccatcaggccccggccagggagcttgagatccaagccagag
cccccctctgaggacctgggaagcctgcaccctggggccctactgtttcgagcgtctggg
catcctccatctcttcccaccatggctgatgcccttgcccatggagctgatgtcaactgg
gtcaatgggggccaagataatgccacaccgctgatccaggccacagctgctaattctctt
ctggcctgtgagtttctcctccagaacggggcgaacgtgaaccaagcggacagtgcgggc
cggggcccgctgcaccacgcaaccattcttggccacacggggctcgcctgcctgttcctg
aaacggggagctgatctgggggctcgagactctgaaggcagggaccctctgaccatcgcc
atggaaacagccaacgctgacatcgtcaccctgctacgactggcaaagatgagggaggct
gaagcggcccaggggcaggcaggagatgagacgtatcttgacatcttccgcgacttctcc
ctcatggcgtcagacgacccggagaagctgagccgtcgcagtcatgacctccacacgctg
tga

KEGG   Homo sapiens (human): 9815
Entry
9815              CDS       T01001                                 
Symbol
GIT2, CAT-2, CAT2, PKL
Name
(RefSeq) GIT ArfGAP 2
  KO
K12487  G protein-coupled receptor kinase interactor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01070  ITGA/B-FAK-CDC42 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    9815 (GIT2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    9815 (GIT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9815 (GIT2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    9815 (GIT2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    9815 (GIT2)
SSDB
Motif
Pfam: GIT1_C GIT_CC ArfGap GIT_SHD Ank_2 Ank_5 Ank_4 Ank TTRAP DMPK_coil Shugoshin_N YabA
Other DBs
NCBI-GeneID: 9815
NCBI-ProteinID: NP_476510
OMIM: 608564
HGNC: 4273
Ensembl: ENSG00000139436
Pharos: Q14161(Tbio)
UniProt: Q14161
LinkDB
Position
12:complement(109929804..110000164)
AA seq 759 aa
MSKRLRSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLKHTPWPPTL
LQMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRL
PCRDDDSVTAKDLSKQLHSSVRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQI
LQAELLAVYGADPGTQDSSGKTPVDYARQGGHHELAERLVEIQYELTDRLAFYLCGRKPD
HKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEELAMDVYDEVDRRETDAVWLA
TQNHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDILSDAKRRQQGS
SLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDL
SDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLQTLQSENSNLRKQAT
TNVYQVQTGSEYTDTSNHSSLKRRPSARGSRPMSMYETGSGQKPYLPMGEASRPEESRMR
LQPFPAHIGRSALVTSSSSLPSFPSTLSWSRDESARRASRLEKQNSTPESDYDNTPNDME
PDGMGSSRKGRQRSMVWPGDGLVPDTAEPHVAPSPTLPSTEDVIRKTEQITKNIQELLRA
AQENKHDSYIPCSERIHVAVTEMAALFPKKPKSDMVRTSLRLLTSSAYRLQSECKKTLPG
DPGSPTDVQLVTQQVIQCAYDIAKAAKQLVTITTKENNN
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgtcgaaacggctccggagcagcgaggtgtgcgctgactgcagcgggccggatccttcc
tgggcatcagtaaataggggaacgtttttatgtgatgagtgctgcagtgtccatcggagt
ctagggcgccatatctcccaagtgaggcatctgaaacacacaccgtggcctccaacactg
cttcagatggttgagaccttgtataataacggtgctaactctatatgggagcattctttg
ctggaccctgcgtctattatgagtggaagacgtaaagctaatccacaggataaagtacat
cccaataaagcggaattcatcagagccaagtatcagatgttagcgttcgtccatcgcttg
ccctgccgggatgacgatagtgtgactgccaaagatcttagcaagcaactccattcgagc
gtgagaacagggaatcttgaaacctgtttgagactgttatctttaggagcacaagccaac
ttctttcatcctgaaaaaggaaacaccccactccatgttgcctccaaagcagggcagatt
ttacaggctgaattattggcagtatatggagcagacccaggcacacaggattctagtggg
aaaactcccgttgattatgcaaggcaaggagggcaccatgagctggcagagcgcctcgtg
gaaatacagtatgagctaacggacagactagccttctatctctgtggcaggaaaccagat
cacaaaaatggacagcactttataatacctcaaatggcagacagcagcctggatttgtct
gaattggcaaaagctgctaagaagaaacttcaatctctaagtaatcatttgtttgaagaa
cttgccatggatgtgtacgatgaagttgacaggcgagagacggatgcagtctggcttgcc
acgcaaaaccacagcgccctggtaaccgagacaacggtcgtcccctttcttccggtcaat
cctgagtactcatcaacacgaaatcagggcagacagaagttagctcggttcaacgcccat
gagtttgccacgctggtcattgacattctcagtgacgccaagaggagacagcagggcagt
tctctctcgggttcaaaagacaatgtggagctcatactgaaaaccatcaataaccagcac
agcgttgagagtcaagacaacgatcagcccgactatgacagcgtggcatcagacgaagac
acagatttggaaaccactgcaagcaaaacaaaccggcagaagagcctagattcagattta
tcagatggaccagtcactgtacaggaatttatggaggtcaaaaacgctctagtggcttct
gaggccaagatacagcagctaatgaaggtgaataacaacttgagtgacgagctgagaatt
atgcagaaaaagcttcaaacactccagagtgaaaattcgaacctcaggaaacaggccaca
accaatgtatatcaggtgcaaactggttctgagtacacagacacttccaaccactcttcc
ttaaagagacgtccgtctgcccggggcagtaggcccatgtccatgtacgagaccggatca
ggtcagaaaccatatctcccaatgggagaagcgagccgccccgaagagagcaggatgaga
ctccagcccttccccgcgcacatcgggaggagtgcacttgtgacctcctcttcatctctg
ccttccttcccctccacactttcctggtcgagggacgaaagcgcccgaagggcatccagg
ctggagaagcagaacagcacacctgagagtgactacgacaacactcccaacgacatggag
ccagatggcatggggtcaagccgaaagggacggcaaagaagtatggtgtggccaggggat
ggcttggtaccagacacagcagaaccccatgtggccccaagccccactctccctagcacc
gaagatgtcatcaggaagactgaacagatcaccaaaaacatacaggagctcttaagagca
gcccaagaaaataaacatgacagttatattccctgctcagagaggatacacgtagctgtt
acagaaatggcagcattattccccaaaaaacccaagtctgatatggtgaggacttccctt
cgtttactgacgtccagtgcctaccgactgcagtcagagtgcaagaagaccctcccaggg
gaccccggctcacccacagacgttcagctggtcacgcagcaggtcatccagtgtgcgtac
gacatcgccaaggctgccaagcagctggttaccatcaccaccaaagagaacaacaactga

DBGET integrated database retrieval system