KEGG   Homo sapiens (human): 117157
Entry
117157            CDS       T01001                                 
Symbol
SH2D1B, EAT2
Name
(RefSeq) SH2 domain containing 1B
  KO
K07989  SH2 domain-containing protein 1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    117157 (SH2D1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    117157 (SH2D1B)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   117157 (SH2D1B)
SSDB
Motif
Pfam: SH2 AA_permease_N
Other DBs
NCBI-GeneID: 117157
NCBI-ProteinID: NP_444512
OMIM: 608510
HGNC: 30416
Ensembl: ENSG00000198574
Pharos: O14796(Tbio)
UniProt: O14796
Structure
LinkDB
Position
1:complement(162395268..162412136)
AA seq 132 aa
MDLPYYHGRLTKQDCETLLLKEGVDGNFLLRDSESIPGVLCLCVSFKNIVYTYRIFREKH
GYYRIQTAEGSPKQVFPSLKELISKFEKPNQGMVVHLLKPIKRTSPSLRWRGLKLELETF
VNSNSDYVDVLP
NT seq 399 nt   +upstreamnt  +downstreamnt
atggatctgccttactaccatggacgtctgaccaagcaagactgtgagaccttgctgctc
aaggaaggggtggatggcaactttcttttaagagacagcgagtcgataccaggagtcctg
tgcctctgtgtctcgtttaaaaatattgtctacacataccgaatcttcagagagaaacac
gggtattacaggatacagactgcagaaggttctccaaaacaggtctttccaagcctaaag
gaactgatctccaaatttgaaaaaccaaatcaggggatggtggttcaccttttaaagcca
ataaagagaaccagccccagcttgagatggagaggattgaaattagagttggaaacattt
gtgaacagtaacagcgattatgtggatgtcttgccttga

DBGET integrated database retrieval system