KEGG   Homo sapiens (human): 118813
Entry
118813            CDS       T01001                                 
Symbol
ZFYVE27, PROTRUDIN, SPG33
Name
(RefSeq) zinc finger FYVE-type containing 27
  KO
K19368  protrudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Disease
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    118813 (ZFYVE27)
SSDB
Motif
Pfam: FYVE FYVE_2
Other DBs
NCBI-GeneID: 118813
NCBI-ProteinID: NP_653189
OMIM: 610243
HGNC: 26559
Ensembl: ENSG00000155256
Pharos: Q5T4F4(Tbio)
UniProt: Q5T4F4
Structure
LinkDB
Position
10:97737128..97760895
AA seq 411 aa
MQTSEREGSGPELSPSVMPEAPLESPPFPTKSPAFDLFNLVLSYKRLEIYLEPLKDAGDG
VRYLLRWQMPLCSLLTCLGLNVLFLTLNEGAWYSVGALMISVPALLGYLQEVCRARLPDS
ELMRRKYHSVRQEDLQRGRLSRPEAVAEVKSFLIQLEAFLSRLCCTCEAAYRVLHWENPV
VSSQFYGALLGTVCMLYLLPLCWVLTLLNSTLFLGNVEFFRVVSEYRASLQQRMNPKQEE
HAFESPPPPDVGGKDGLMDSTPALTPTEDLTPGSVEEAEEAEPDEEFKDAIEETHLVVLE
DDEGAPCPAEDELALQDNGFLSKNEVLRSKVSRLTERLRKRYPTNNFGNCTGCSATFSVL
KKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgcagacatcagaacgtgaggggagtgggccggagctgagccccagcgtgatgcccgag
gctcccctggagtctccaccttttcctaccaagtccccagcgtttgaccttttcaacttg
gttctctcctacaagaggctggagatctacctggaacccttgaaggatgcaggtgatggt
gttcgatacttgctcaggtggcagatgcctttgtgttccttgctgacctgcctgggcctc
aacgtcttgttcctcactttgaatgagggtgcatggtactcagtaggtgccctgatgatt
tcagtgcccgccctgctgggctaccttcaggaggtttgccgggcacggctgcctgattcc
gagctgatgcggaggaagtatcatagcgtgaggcaggaggacctgcagagaggtcgcctg
tctcgtcccgaggccgtggctgaggtgaagagcttcttgatccagctggaggccttcctg
agccgcctgtgctgcacatgtgaagccgcctaccgcgtgctgcactgggagaaccccgtc
gtgtcctcacagttctatggggctcttctgggcacagtctgcatgctgtatttgctgcca
ctctgctgggttctcacccttttaaacagcacgctctttctggggaatgtggagttcttc
cgagttgtgtctgagtacagggcatctctgcagcagaggatgaacccaaagcaggaagag
catgcctttgagagtcctccaccaccagatgttggggggaaggatggtctgatggacagc
acgcctgccctcacacccacggaggacctcacaccgggcagcgtggaggaggctgaggag
gctgagccagatgaagagtttaaagatgcgattgaggagacccacttggtggtgctggag
gatgatgagggcgccccgtgcccagcagaggatgagctggccctgcaggacaacgggttc
ctgagcaagaatgaggtgctgcgcagcaaggtgtctcggctcacggagcggctccgcaag
cgctaccccaccaacaacttcgggaactgcacgggctgctcggccaccttctcagtgctg
aagaagaggcggagctgcagtaattgtggaaacagcttctgctctcgatgctgctccttc
aaggtgcccaagtcctccatgggggccacagcccctgaagcccagagggagactgtgttt
gtgtgtgcctcgtgtaaccagaccttgagcaagtga

DBGET integrated database retrieval system