KEGG   Homo sapiens (human): 121504
Entry
121504            CDS       T01001                                 
Symbol
H4-16, H4/p, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, HIST4H4
Name
(RefSeq) H4 histone 16
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    121504 (H4-16)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    121504 (H4-16)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    121504 (H4-16)
  09165 Substance dependence
   05034 Alcoholism
    121504 (H4-16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    121504 (H4-16)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    121504 (H4-16)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 121504
NCBI-ProteinID: NP_778224
OMIM: 615069
HGNC: 20510
Ensembl: ENSG00000197837
Vega: OTTHUMG00000168735
UniProt: P62805 B2R4R0
Structure
LinkDB
Position
12:complement(14770720..14771131)
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctgggcgaggtaaaggtggcaaggggctgggtaagggaggcgccaagcgccaccgg
aaggtgctgcgggacaatatccaaggcattacaaagccggcgattcgccgtctcgcccga
cgtgggggcgtcaagcgcatttctggtctcatctacgaggagacccggggagtcctcaaa
gtcttcctggagaacgtgatccgtgacgcggtgacttacacggagcacgccaagcgcaag
accgtcacggccatggatgtggtgtacgcgctgaaacgccagggtcgcaccctttatggt
ttcggcggttga

KEGG   Homo sapiens (human): 554313
Entry
554313            CDS       T01001                                 
Symbol
H4C15, H4-16, H4/o, H4C1, H4C11, H4C12, H4C13, H4C14, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, HIST2H4B
Name
(RefSeq) H4 clustered histone 15
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    554313 (H4C15)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    554313 (H4C15)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    554313 (H4C15)
  09165 Substance dependence
   05034 Alcoholism
    554313 (H4C15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    554313 (H4C15)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    554313 (H4C15)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 554313
NCBI-ProteinID: NP_001029249
HGNC: 29607
Ensembl: ENSG00000270276
Vega: OTTHUMG00000188201
UniProt: P62805 B2R4R0
Structure
LinkDB
Position
1:complement(149844488..149861240)
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtccggcagaggaaagggcggaaaaggcttaggcaaagggggcgctaagcgccaccgc
aaggtcttgagagacaacattcagggcatcaccaagcctgccattcggcgtctagctcgg
cgtggcggcgttaagcggatctctggcctcatttacgaggagacccgcggtgtgctgaag
gtgttcctggagaatgtgattcgggacgcagtcacctacaccgagcacgccaagcgcaag
accgtcacagccatggatgtggtgtacgcgctcaagcgccaggggcgcaccctgtacggc
ttcggaggctag

KEGG   Homo sapiens (human): 8294
Entry
8294              CDS       T01001                                 
Symbol
H4C9, H4-16, H4/m, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4FM, H4M, HIST1H4I
Name
(RefSeq) H4 clustered histone 9
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8294 (H4C9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8294 (H4C9)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8294 (H4C9)
  09165 Substance dependence
   05034 Alcoholism
    8294 (H4C9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8294 (H4C9)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8294 (H4C9)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8294
NCBI-ProteinID: NP_003486
OMIM: 602833
HGNC: 4793
Ensembl: ENSG00000276180
Vega: OTTHUMG00000014471
UniProt: P62805 B2R4R0
Structure
LinkDB
Position
6:27139282..27139678
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtcaggacgcggcaaaggaggtaagggcctggggaaagggggtgccaagcgccaccgc
aaggtgctgcgcgacaacatccagggtatcaccaagccagccattcggcgccttgctcgc
cgcggcggcgtgaagcgcatttctggcctcatctatgaggagacccgcggagtgttgaag
gtgttcctggagaacgtgatccgggacgccgtgacctacacggagcacgccaagcgcaag
acggtcaccgccatggacgtggtctacgcgctcaagcgccagggccgcaccctctatggc
ttcggcggctaa

KEGG   Homo sapiens (human): 8359
Entry
8359              CDS       T01001                                 
Symbol
H4C1, H4-16, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4FA, HIST1H4A
Name
(RefSeq) H4 clustered histone 1
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8359 (H4C1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8359 (H4C1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8359 (H4C1)
  09165 Substance dependence
   05034 Alcoholism
    8359 (H4C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8359 (H4C1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8359 (H4C1)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8359
NCBI-ProteinID: NP_003529
OMIM: 602822
HGNC: 4781
Ensembl: ENSG00000278637
Vega: OTTHUMG00000014419
UniProt: P62805 B2R4R0
Structure
LinkDB
Position
6:26021649..26022050
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggacgtggtaagggcgggaagggtttgggtaaggggggtgccaagcgccaccgc
aaggtgttgcgtgacaacatccagggcatcaccaagccggccatccggcgtctggcccgg
cgtggcggtgtgaagcggatctctggtctgatctacgaggagactcgcggggtgctcaag
gtgtttttggagaacgtgatccgtgacgctgtcacctatacggagcacgccaagcgcaag
acagtcactgccatggacgtggtctacgcgcttaagcgccagggacgcaccctttatggc
tttggcggttaa

KEGG   Homo sapiens (human): 8360
Entry
8360              CDS       T01001                                 
Symbol
H4C4, H4-16, H4/b, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C5, H4C6, H4C8, H4C9, H4FB, HIST1H4D, dJ221C16.9
Name
(RefSeq) H4 clustered histone 4
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8360 (H4C4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8360 (H4C4)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8360 (H4C4)
  09165 Substance dependence
   05034 Alcoholism
    8360 (H4C4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8360 (H4C4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8360 (H4C4)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8360
NCBI-ProteinID: NP_003530
OMIM: 602823
HGNC: 4782
Ensembl: ENSG00000277157
Vega: OTTHUMG00000014423
UniProt: P62805 B2R4R0
Structure
LinkDB
Position
6:complement(26188710..26189112)
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggccgcggtaagggcggaaagggtctaggtaagggtggcgccaagcgtcaccgt
aaggtattgcgtgacaatatccaaggaatcaccaagcccgctatccgccgcctggctcgc
cgcggcggcgtcaagcgtatttctggcctcatttatgaggaaactcgcggagtgctgaaa
gttttcctggaaaatgtaatccgcgatgctgtcacctacacggaacacgccaaacgcaag
acagtcacagccatggacgtggtgtacgcgctcaagcgccagggacgcactctttatggc
ttcggcggctga

KEGG   Homo sapiens (human): 8361
Entry
8361              CDS       T01001                                 
Symbol
H4C6, H4, H4-16, H4/c, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C8, H4C9, H4FC, HIST1H4F
Name
(RefSeq) H4 clustered histone 6
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8361 (H4C6)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8361 (H4C6)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8361 (H4C6)
  09165 Substance dependence
   05034 Alcoholism
    8361 (H4C6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8361 (H4C6)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8361 (H4C6)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8361
NCBI-ProteinID: NP_003531
OMIM: 602824
HGNC: 4783
Ensembl: ENSG00000274618
Vega: OTTHUMG00000014443
UniProt: P62805 B2R4R0
Structure
LinkDB
Position
6:26240393..26240793
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggtagaggcaaaggtggtaaaggtttaggaaagggaggcgccaagcgccatcgc
aaagtgctgcgtgacaacatacagggcatcacgaagcccgccatccgtcgcttggcccga
cgcggcggcgtgaaacgcatttcgggcctcatttatgaggagacccgcggtgttcttaag
gtgttcctggagaatgtgatacgggacgccgtaacctacacggagcacgccaagcgtaag
acagtcactgcaatggatgttgtctacgcgctcaagcgccagggacgcactctgtacggc
tttggtggctga

KEGG   Homo sapiens (human): 8362
Entry
8362              CDS       T01001                                 
Symbol
H4C12, H4-16, H4/d, H4C1, H4C11, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2iii, H4FD, HIST1H4K, dJ160A22.1
Name
(RefSeq) H4 clustered histone 12
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8362 (H4C12)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8362 (H4C12)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8362 (H4C12)
  09165 Substance dependence
   05034 Alcoholism
    8362 (H4C12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8362 (H4C12)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8362 (H4C12)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8362
NCBI-ProteinID: NP_003532
OMIM: 602825
HGNC: 4784
Ensembl: ENSG00000273542
Vega: OTTHUMG00000014488
UniProt: P62805 B2R4R0
Structure
LinkDB
Position
6:complement(27831174..27831560)
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggccgcggcaaaggcgggaagggtcttggcaaaggcggcgctaagcgccaccgt
aaagtactgcgcgacaatatccagggcatcaccaagccggccatccggcgccttgctcgc
cgcggcggcgtgaagcgcatctccggcctcatctacgaggagactcgcggggtgctgaag
gtgttcctggagaacgtgatccgggacgccgtgacctatacagagcacgccaagcgcaag
acggtcaccgccatggatgtggtctacgcgctcaagcgccagggccgcaccctctacggt
ttcggtggttga

KEGG   Homo sapiens (human): 8363
Entry
8363              CDS       T01001                                 
Symbol
H4C11, H4-16, H4/e, H4C1, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2iv, H4FE, HIST1H4J, TEVANED2, dJ160A22.2
Name
(RefSeq) H4 clustered histone 11
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8363 (H4C11)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8363 (H4C11)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8363 (H4C11)
  09165 Substance dependence
   05034 Alcoholism
    8363 (H4C11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8363 (H4C11)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8363 (H4C11)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8363
NCBI-ProteinID: NP_068803
OMIM: 602826
HGNC: 4785
Ensembl: ENSG00000197238
Vega: OTTHUMG00000014487
UniProt: P62805 B2R4R0
Structure
LinkDB
Position
6:27824092..27824480
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggccgcggcaaaggcgggaagggtcttggcaaaggcggcgctaagcgccaccgt
aaagtactgcgcgacaatatccagggcatcaccaagccggccatccggcgccttgctcgc
cgcggcggcgtgaagcgcatctccggcctcatctacgaggagactcgcggggtgctgaag
gtgttcctggagaacgtgatccgggacgccgtgacctatacagagcacgccaagcgcaag
acggtcaccgccatggatgtggtctacgcgctcaagcgccagggccgcaccctctacggt
ttcggtggttga

KEGG   Homo sapiens (human): 8364
Entry
8364              CDS       T01001                                 
Symbol
H4C3, H4-16, H4/g, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C4, H4C5, H4C6, H4C8, H4C9, H4FG, HIST1H4C, TEVANED1, dJ221C16.1
Name
(RefSeq) H4 clustered histone 3
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8364 (H4C3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8364 (H4C3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8364 (H4C3)
  09165 Substance dependence
   05034 Alcoholism
    8364 (H4C3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8364 (H4C3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8364 (H4C3)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8364
NCBI-ProteinID: NP_003533
OMIM: 602827
HGNC: 4787
Ensembl: ENSG00000197061
Vega: OTTHUMG00000014429
UniProt: P62805 B2R4R0
Structure
LinkDB
Position
6:26103933..26104337
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggtcgcggcaaaggcggaaaaggcttggggaagggtggtgctaagcgccatcgt
aaggtgctccgggataacatccagggcattacaaaaccggctattcgccgtttggctcgg
cgcggtggcgtcaagcgcatttccggtcttatctatgaggagactcgaggtgtgcttaag
gttttcttagagaacgttattcgagacgccgtcacctatacggagcacgccaagcgcaaa
actgtcacagccatggatgtagtatatgccctaaaacgtcaggggcgcactctgtatggc
ttcggcggctga

KEGG   Homo sapiens (human): 8365
Entry
8365              CDS       T01001                                 
Symbol
H4C8, H4-16, H4/h, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C9, H4FH, HIST1H4H
Name
(RefSeq) H4 clustered histone 8
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8365 (H4C8)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8365 (H4C8)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8365 (H4C8)
  09165 Substance dependence
   05034 Alcoholism
    8365 (H4C8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8365 (H4C8)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8365 (H4C8)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8365
NCBI-ProteinID: NP_003534
OMIM: 602828
HGNC: 4788
Ensembl: ENSG00000158406
Vega: OTTHUMG00000014454
UniProt: P62805 B2R4R0
Structure
LinkDB
Position
6:complement(26285126..26285534)
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggccgtggtaaaggtggaaaaggtttgggtaagggaggagctaagcgtcatcgc
aaggttttgcgcgataacatccagggcatcactaagccagctatccggcgccttgctcgt
cgcggcggtgtcaagcgaatttctggccttatctatgaggagactcgtggtgttctgaag
gtgttcctggagaacgtgattcgtgacgctgtcacttacacagagcacgccaaacgcaag
accgtgacagcaatggatgtggtctacgcgctgaagcgacagggacgcactctttacggc
ttcggtggctaa

KEGG   Homo sapiens (human): 8366
Entry
8366              CDS       T01001                                 
Symbol
H4C2, H4-16, H4/I, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4FI, HIST1H4B
Name
(RefSeq) H4 clustered histone 2
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8366 (H4C2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8366 (H4C2)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8366 (H4C2)
  09165 Substance dependence
   05034 Alcoholism
    8366 (H4C2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8366 (H4C2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8366 (H4C2)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8366
NCBI-ProteinID: NP_003535
OMIM: 602829
HGNC: 4789
Ensembl: ENSG00000278705
Vega: OTTHUMG00000014417
UniProt: P62805 B2R4R0
Structure
LinkDB
Position
6:complement(26026896..26027283)
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggtcgcggcaaaggcggtaaaggtttgggtaagggaggtgccaagcgtcaccga
aaagtgctgcgggataacatccaaggcatcaccaaaccggccattcggcgccttgctagg
cgtggtggggttaagcgaatttccggtttgatttatgaggagactcgtggcgttctcaag
gtgtttctggagaacgtgatccgggacgccgtgacctacacggagcacgccaagcgcaag
actgtcactgccatggatgtggtttacgcgctcaagcgtcaaggacgcactctgtacggc
ttcggcggttaa

KEGG   Homo sapiens (human): 8367
Entry
8367              CDS       T01001                                 
Symbol
H4C5, H4-16, H4/j, H4C1, H4C11, H4C12, H4C13, H4C14, H4C15, H4C2, H4C3, H4C4, H4C6, H4C8, H4C9, H4FJ, HIST1H4E
Name
(RefSeq) H4 clustered histone 5
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8367 (H4C5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8367 (H4C5)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8367 (H4C5)
  09165 Substance dependence
   05034 Alcoholism
    8367 (H4C5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8367 (H4C5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8367 (H4C5)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8367
NCBI-ProteinID: NP_003536
OMIM: 602830
HGNC: 4790
Ensembl: ENSG00000276966
Vega: OTTHUMG00000014441
UniProt: P62805 B2R4R0
Structure
LinkDB
Position
6:26204610..26205021
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctggtcgcggcaaaggcggaaagggactgggtaaaggaggcgctaagcgtcaccgt
aaggtcctgcgagataacatccagggcattaccaagcctgccatccggcgccttgctcgt
cgcgggggtgtcaagcgcatttctggtctcatctacgaggagactcgcggggttctgaag
gtgtttctggaaaacgtgattcgtgatgctgtgacttacacggagcacgccaaacgcaag
acagtgacagcgatggatgtggtctacgcgctgaagagacagggacgcactctttacggc
ttcggcggctaa

KEGG   Homo sapiens (human): 8368
Entry
8368              CDS       T01001                                 
Symbol
H4C13, H4-16, H4.k, H4/k, H4C1, H4C11, H4C12, H4C14, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4FK, HIST1H4L
Name
(RefSeq) H4 clustered histone 13
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8368 (H4C13)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8368 (H4C13)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8368 (H4C13)
  09165 Substance dependence
   05034 Alcoholism
    8368 (H4C13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8368 (H4C13)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8368 (H4C13)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8368
NCBI-ProteinID: NP_003537
OMIM: 602831
HGNC: 4791
Ensembl: ENSG00000275126
Vega: OTTHUMG00000016211
UniProt: P62805 B2R4R0
Structure
LinkDB
Position
6:complement(27873148..27873534)
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtctgggcgcggcaaaggcgggaagggtctgggcaaaggaggcgctaagcgccaccgc
aaagttctgcgcgacaacattcagggcatcaccaagcccgccatccgacgcctggcacgg
cgtggaggcgttaagcgcatctcaggccttatatacgaggagacacgcggagttcttaaa
gtgtttttggagaatgtaatccgcgatgcagttacctacacggagcacgccaaacgcaag
acagtcacagccatggacgtggtttacgcgctcaagcgccagggccgcaccctgtatggc
tttggcggctga

KEGG   Homo sapiens (human): 8369
Entry
8369              CDS       T01001                                 
Symbol
H4C7, H4/l, H4FL, HIST1H4G
Name
(RefSeq) H4 clustered histone 7
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8369 (H4C7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8369 (H4C7)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8369 (H4C7)
  09165 Substance dependence
   05034 Alcoholism
    8369 (H4C7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8369 (H4C7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8369 (H4C7)
SSDB
Motif
Pfam: CENP-T_C
Other DBs
NCBI-GeneID: 8369
NCBI-ProteinID: NP_003538
OMIM: 602832
HGNC: 4792
Ensembl: ENSG00000275663
Vega: OTTHUMG00000014444
Pharos: Q99525(Tdark)
UniProt: Q99525
LinkDB
Position
6:complement(26246611..26246996)
AA seq 98 aa
MSVRGKAGKGLGKGGAKCHRKVLSDNIQGITKCTIRRLARHGGVKRILGLIYEETRRVFK
VFLENVIWYAVTNTEHAKRKTVTAMAVVYVLKRQGRTL
NT seq 297 nt   +upstreamnt  +downstreamnt
atgtctgttcggggcaaggccggaaaaggccttgggaaaggcggtgccaagtgccatcgc
aaggtactgagcgataatattcagggcattaccaagtgcactatccggcgcttggcccgg
catggcggtgtcaagcgcatcttgggcctcatttatgaggagacccgccgggtgttcaag
gtgttcctggaaaatgtgatctggtacgccgtgaccaacacggagcacgccaagcgcaag
acggtcaccgccatggccgtggtctacgtgctcaaacgccagggaagaaccctgtaa

KEGG   Homo sapiens (human): 8370
Entry
8370              CDS       T01001                                 
Symbol
H4C14, FO108, H4, H4-16, H4/n, H4C1, H4C11, H4C12, H4C13, H4C15, H4C2, H4C3, H4C4, H4C5, H4C6, H4C8, H4C9, H4F2, H4FN, HIST2H4, HIST2H4A
Name
(RefSeq) H4 clustered histone 14
  KO
K11254  histone H4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    8370 (H4C14)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8370 (H4C14)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8370 (H4C14)
  09165 Substance dependence
   05034 Alcoholism
    8370 (H4C14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8370 (H4C14)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8370 (H4C14)
SSDB
Motif
Pfam: CENP-T_C TAF CENP-S Histone CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137
Other DBs
NCBI-GeneID: 8370
NCBI-ProteinID: NP_003539
OMIM: 142750
HGNC: 4794
Ensembl: ENSG00000270882
Vega: OTTHUMG00000012189
Pharos: P62805(Tbio)
UniProt: P62805 B2R4R0
Structure
LinkDB
Position
1:149832657..149833052
AA seq 103 aa
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
NT seq 312 nt   +upstreamnt  +downstreamnt
atgtccggcagaggaaagggcggaaaaggcttaggcaaagggggcgctaagcgccaccgc
aaggtcttgagagacaacattcagggcatcaccaagcctgccattcggcgtctagctcgg
cgtggcggcgttaagcggatctctggcctcatttacgaggagacccgcggtgtgctgaag
gtgttcctggagaatgtgattcgggacgcagtcacctacaccgagcacgccaagcgcaag
accgtcacagccatggatgtggtgtacgcgctcaagcgccaggggcgcaccctgtacggc
ttcggaggctag

DBGET integrated database retrieval system