KEGG   Homo sapiens (human): 122786
Entry
122786            CDS       T01001                                 
Symbol
FRMD6, C14orf31, EX1, Willin, c14_5320
Name
(RefSeq) FERM domain containing 6
  KO
K16822  FERM domain-containing protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    122786 (FRMD6)
   04392 Hippo signaling pathway - multiple species
    122786 (FRMD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    122786 (FRMD6)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Other domain-containing proteins
  FERM domain-containing proteins
   122786 (FRMD6)
SSDB
Motif
Pfam: FERM_N FERM_M FERM_C HTH_24
Other DBs
NCBI-GeneID: 122786
NCBI-ProteinID: NP_001253975
OMIM: 614555
HGNC: 19839
Ensembl: ENSG00000139926
Vega: OTTHUMG00000140294
Pharos: Q96NE9(Tbio)
UniProt: Q96NE9
LinkDB
Position
14:51396431..51730727
AA seq 622 aa
MNKLNFHNNRVMQDRRSVCIFLPNDESLNIIINVKILCHQLLVQVCDLLRLKDCHLFGLS
VIQNNEHVYMELSQKLYKYCPKEWKKEASKVRQYEVTWGIDQFGPPMIIHFRVQYYVENG
RLISDRAARYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRNKHYGKYFEPE
AYFPSWVVSKRGKDYILKHIPNMHKDQFALTASEAHLKYIKEAVRLDDVAVHYYRLYKDK
REIEASLTLGLTMRGIQIFQNLDEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKL
IYYTGCPMRSRHLLQLLSNSHRLYMNLQPVLRHIRKLEENEEKKQYRESYISDNLDLDMD
QLEKRSRASGSSAGSMKHKRLSRHSTASHSSSHTSGIEADTKPRDTGPEDSYSSSAIHRK
LKTCSSMTSHGSSHTSGVESGGKDRLEEDLQDDEIEMLVDDPRDLEQMNEESLEVSPDMC
IYITEDMLMSRKLNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDR
HSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCINIQDAFP
VKRTSKYFSLDLTHDEVPEFVV
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgaacaaattgaattttcataacaacagagtcatgcaagaccgccgcagtgtgtgcatt
ttccttcccaacgatgaatctctgaacatcatcataaatgttaagattctgtgtcaccag
ttgctggtccaggtttgtgacctgctcaggctaaaggactgccacctctttggactcagt
gttatacaaaataatgaacatgtgtatatggagttgtcacaaaagctttacaaatattgt
ccaaaagaatggaagaaagaggccagcaaggtacgacaatacgaagtcacttggggtatc
gaccaatttgggcctcctatgatcatccacttccgtgtgcagtactatgtggaaaatggc
agattgatcagtgacagagcagcaagatactattattactggcacctgagaaaacaagtt
cttcattctcagtgtgtgctccgagaggaggcctacttcctgctggcagcctttgccctg
caggctgatcttgggaacttcaaaaggaataagcactatggaaaatacttcgagccagag
gcttacttcccatcttgggttgtttccaagagggggaaggactacatcctgaagcacatt
ccaaacatgcacaaagatcagtttgcactaacagcttccgaagctcatcttaaatatatc
aaagaggctgtccgactggatgacgtcgctgttcattactacagattgtataaggataaa
agggaaattgaagcatcgctgactcttggattgaccatgaggggaatacagatttttcag
aatttagatgaagagaaacaattactttatgatttcccctggacaaatgttggaaaattg
gtgtttgtgggtaagaaatttgagattttgccagatggcttgccttctgcccggaagctc
atatactacacggggtgccccatgcgctccagacacctcctgcaacttctgagcaacagc
caccgcctctatatgaatctgcagcctgtcctgcgccatatccggaagctggaggaaaac
gaagagaagaagcagtaccgggaatcttacatcagtgacaacctggacctcgacatggac
cagctggaaaaacggtcgcgggccagcgggagcagtgcgggcagcatgaaacacaagcgc
ctgtcccgtcattccaccgccagccacagcagttcccacacctcgggcattgaggcagac
accaagccccgggacacggggccagaagacagctactccagcagtgccatccaccgcaag
ctgaaaacctgcagctcaatgaccagtcatggcagctcccacacctcaggggtggagagt
ggcggcaaagaccggctggaagaggacttacaggacgatgaaatagagatgttggttgat
gacccccgggatctggagcagatgaatgaagagtctctggaagtcagcccagacatgtgc
atctacatcacagaggacatgctcatgtcgcggaagctgaatggacactctgggttgatt
gtgaaagaaattgggtcttccacctcgagctcttcagaaacagttgttaagcttcgtggc
cagagtactgattctcttccacagactatatgtcggaaaccaaagacctccactgatcga
cacagcttgagcctcgatgacatcagactttaccagaaagacttcctgcgcattgcaggt
ctgtgtcaggacactgctcagagttacacctttggatgtggccatgaactggatgaggaa
ggcctctattgcaacagttgcttggcccagcagtgcatcaacatccaagatgcttttcca
gtcaaaagaaccagcaaatacttttctctggatctcactcatgatgaagttccagagttt
gttgtgtaa

KEGG   Homo sapiens (human): 79981
Entry
79981             CDS       T01001                                 
Symbol
FRMD1, bA164L23.1
Name
(RefSeq) FERM domain containing 1
  KO
K16821  FERM domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    79981 (FRMD1)
   04392 Hippo signaling pathway - multiple species
    79981 (FRMD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    79981 (FRMD1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Other domain-containing proteins
  FERM domain-containing proteins
   79981 (FRMD1)
SSDB
Motif
Pfam: FERM_M FERM_N FAM165 FERM_C
Other DBs
NCBI-GeneID: 79981
NCBI-ProteinID: NP_079195
HGNC: 21240
Ensembl: ENSG00000153303
Vega: OTTHUMG00000016037
Pharos: Q8N878(Tdark)
UniProt: Q8N878
LinkDB
Position
6:complement(168053095..168093056)
AA seq 549 aa
MAVPPRGRGIDPARTNPDTFPPSGARCMEPSPERPACSQQEPTLGMDAMASEHRDVLVLL
PSREQLRLAVGVKATGRELFQQVCNVASIRDAQFFGLCVVRNNEYIFMDLEQKLSKYFSK
DWKKERNEGNEKPRAPFVAFLRVQHYVENGRVISDHRARHLYYCHLKERVLRSQCAHREE
AYFLLAACALQADLGEHRESAHAGRYFEPHSYFPQWIITKRGIDYILRHMPTLHRERQGL
SPKEAMLCFIQEACRLEDVPVHFFRLHKDKKEGRPTVILGLALRGVHIYQGKKLEIQLDG
LPAAQKLVYYTGCTWRSRHLLHLLRASHQLHLRVRPTLQQLRQREEAEEKQHYRESYISD
ELELDLASRSFPGSGVSSQHCPHCLSRHSADSHGSSYTSGIKANSWLRESREMSVDVPLE
VHGLHEKEPSSSPRTSRSHPSTRGDSQATRQEPCTQVRTRGQSAEAVHQIQEMTAGVSEE
QHSHGLDDMQLHQLALHPAPTSLSHTFHRALDCRLAGPCETRATLPSKRSSNCLALDLFG
EAPPQEFVV
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggcggtgcccccgagagggaggggcatagaccccgcccggacaaaccctgacacgttc
cctccttcaggggcgcgatgtatggaacccagtcctgagaggcctgcatgcagtcagcag
gagccgaccctgggaatggacgcgatggcctcggaacacagggatgtcctcgtgctgctg
cccagccgggagcaactgcggctggccgtgggggtgaaggctactggccgcgagcttttc
cagcaagtgtgcaacgtggcgagcatcagagacgcgcagttctttggcctctgtgtggtc
agaaacaatgagtatatatttatggatttggagcaaaagctcagcaagtacttctcaaaa
gattggaagaaagaaagaaatgaaggaaatgagaaacccagagcccccttcgtggccttc
ctccgagtgcagcactacgtggaaaacggaagggtcataagcgaccacagggcacggcac
ctgtactactgccacttgaaggagcgcgtgctgaggtcacagtgcgctcaccgggaggaa
gcctacttcctgctggctgcctgcgcgctgcaggctgacctgggcgagcaccgggagtcg
gcccatgccgggaggtacttcgagccacactcctacttcccacagtggatcatcaccaag
agggggattgactacatcctccggcacatgcctaccctgcaccgtgagcgccagggcctg
agccccaaggaggccatgctgtgcttcatccaggaggcctgccggctggaggacgtgccc
gtgcacttcttcaggctgcacaaggataagaaggaaggtcgtcccaccgtgatcctggga
ctggccctcaggggagtgcacatctaccagggaaagaagctggagatccagctggatggg
ctgcccgcagcacagaagctggtttactacacggggtgcacctggcggtccaggcacctg
ctgcacctgctgcgcgccagccaccagctccacctccgcgtgcggcccactctgcaacag
ctgcggcagcgggaggaggcagaagagaagcagcactaccgggagtcctatatcagcgat
gagctggagctggacctggccagcaggagcttcccgggcagtggggtcagcagccagcac
tgcccccactgcctctcacgccactccgccgacagccacggcagttcctacacgtcaggc
atcaaggccaactcctggctcagggaatccagagagatgtctgtggacgtgcccttggag
gtccacgggctccatgagaaggagccgtcctccagccccaggaccagccgcagccacccc
agcacacgtggtgacagccaagccactcgtcaggagccctgcacccaggtcaggaccaga
ggccagagcgccgaggccgtgcaccagatccaggaaatgacagccggggtcagtgaggag
cagcacagccatggcctggacgacatgcagctgcaccagctggccctgcacccagcgccc
acctcactcagccataccttccaccgcgccctggactgcaggctggcaggcccctgcgag
accagggccactctccccagcaagaggtccagcaactgtctcgccctggacctgttcgga
gaggctccaccacaggagtttgtggtgtag

DBGET integrated database retrieval system