KEGG   Homo sapiens (human): 122876
Entry
122876            CDS       T01001                                 
Symbol
GPHB5, B5, GPB5, ZLUT1
Name
(RefSeq) glycoprotein hormone subunit beta 5
  KO
K25484  glycoprotein hormone beta-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    122876 (GPHB5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    122876 (GPHB5)
SSDB
Motif
Pfam: Cys_knot DAN
Other DBs
NCBI-GeneID: 122876
NCBI-ProteinID: NP_660154
OMIM: 609652
HGNC: 18055
Ensembl: ENSG00000179600
Pharos: Q86YW7(Tdark)
UniProt: Q86YW7 A0A0F7RPU1
LinkDB
Position
14:complement(63312835..63318935)
AA seq 130 aa
MKLAFLFLGPMALLLLAGYGCVLGASSGNLRTFVGCAVREFTFLAKKPGCRGLRITTDAC
WGRCETWEKPILEPPYIEAHHRVCTYNETKQVTVKLPNCAPGVDPFYTYPVAIRCDCGAC
STATTECETI
NT seq 393 nt   +upstreamnt  +downstreamnt
atgaagctggcattcctcttccttggccccatggccctcctccttctggctggctatggc
tgtgtcctcggtgcctccagtgggaacctgcgcacctttgtgggctgtgccgtgagggag
tttactttcctggccaagaagccaggctgcaggggccttcggatcaccacggatgcctgc
tggggtcgctgtgagacctgggagaaacccattctggaacccccctatattgaagcccat
catcgagtctgtacctacaacgagaccaaacaggtgactgtcaagctgcccaactgtgcc
ccgggagtcgaccccttctacacctatcccgtggccatccgctgtgactgcggagcctgc
tccactgccaccacggagtgtgagaccatctga

KEGG   Homo sapiens (human): 170589
Entry
170589            CDS       T01001                                 
Symbol
GPHA2, A2, GPA2, ZSIG51
Name
(RefSeq) glycoprotein hormone subunit alpha 2
  KO
K25483  glycoprotein hormone alpha-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    170589 (GPHA2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    170589 (GPHA2)
SSDB
Motif
Pfam: Hormone_6 Cys_knot
Other DBs
NCBI-GeneID: 170589
NCBI-ProteinID: NP_570125
OMIM: 609651
HGNC: 18054
Ensembl: ENSG00000149735
Pharos: Q96T91(Tbio)
UniProt: Q96T91 A0A024R579
LinkDB
Position
11:complement(64934471..64937708)
AA seq 129 aa
MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGH
CESSAFPSRYSVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQ
CDMCRLSRY
NT seq 390 nt   +upstreamnt  +downstreamnt
atgcctatggcgtcccctcaaaccctggtcctctatctgctggtcctggcagtcactgaa
gcctggggccaggaggcagtcatcccaggctgccacttgcaccccttcaatgtgacagtg
cgaagtgaccgccaaggcacctgccagggctcccacgtggcacaggcctgtgtgggccac
tgtgagtccagcgccttcccttctcggtactctgtgctggtggccagtggttaccgacac
aacatcacctccgtctctcagtgctgcaccatcagtggcctgaagaaggtcaaagtacag
ctgcagtgtgtggggagccggagggaggagctcgagatcttcacggccagggcctgccag
tgtgacatgtgtcgcctctctcgctactag

DBGET integrated database retrieval system