KEGG   Homo sapiens (human): 124044
Entry
124044            CDS       T01001                                 
Symbol
SPATA2L, C16orf76, tamo
Name
(RefSeq) spermatogenesis associated 2 like
  KO
K17595  spermatogenesis-associated protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    124044 (SPATA2L)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    124044 (SPATA2L)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     124044 (SPATA2L)
SSDB
Other DBs
NCBI-GeneID: 124044
NCBI-ProteinID: NP_689552
HGNC: 28393
Ensembl: ENSG00000158792
Vega: OTTHUMG00000138047
Pharos: Q8IUW3(Tbio)
UniProt: Q8IUW3
LinkDB
Position
16:complement(89696357..89701705)
AA seq 424 aa
MGSSSLSEDYRQCLERELRRGRAGVCGDPSLRAVLWQILVEDFDLHGALQDDALALLTDG
LWGRADLAPALRGLARAFELLELAAVHLYLLPWRKEFTTIKTFSGGYVHVLKGVLSDDLL
LKSFQKMGYVRRDSHRLMVTALPPACQLVQVALGCFALRLECEILGEVLAQLGTSVLPAE
ELLQARRASGDVASCVAWLQQRLAQDEEPPPLPPRGSPAAYRAPLDLYRDLQEDEGSEDA
SLYGEPSPGPDSPPAELAYRPPLWEQSAKLWGTGGRAWEPPAEELPQASSPPYGALEEGL
EPEPSAFSFLSLRRELSRPGDLATPESSAAASPRRIRAEGVPASAYRSVSEPPGYQAHSC
LSPGALPTLCCDTCRQLHAAHCAALPACRPGHSLRVLLGDAQRRLWLQRAQMDTLLYNSP
GARP
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgggcagcagctcgctgtccgaggactaccgccagtgcctggagcgcgagctgcgacgg
ggccgcgcgggcgtgtgcggggacccctcgctgcgcgcggtgctctggcagatcctggtg
gaggacttcgacctgcacggggcgctgcaggacgacgcgctggctctgctcaccgacggg
ctgtggggccgcgccgacctggcgcccgcgctacgcggcctggctcgcgccttcgagctt
ctggagctcgccgcggtgcacctgtacctgctgccctggaggaaggagttcaccaccatc
aagaccttctctgggggctacgtgcacgtgctgaagggtgtgctctcagacgacctcctc
ctgaagagcttccagaagatgggctacgtacgcagagacagccatcggctcatggtgacc
gccctgccccccgcctgccagctggtgcaggtggccctgggctgcttcgccctccggctg
gagtgtgagatcctgggtgaggtgctggcccagctgggcaccagtgtgctgccagctgag
gagctgctgcaggcacggcgtgccagcggggacgtggcctcctgtgtggcctggctgcag
cagcggctggcccaggatgaggagccgccacccctgcccccccgaggctcccctgctgct
tacagggccccactggacttataccgggacttgcaggaagacgaggggtcggaggacgcc
agcctgtatggggagccgtcaccaggccctgactcgcccccggcggagctggcctacagg
ccaccactctgggagcagagtgccaaactgtggggcactgggggccgggcctgggagccc
ccagctgaggagctgccgcaggccagcagcccaccatatggggccttggaggaggggctg
gaacctgaaccttccgccttctccttcctctctctgcgccgtgagctgagtaggcctggg
gacctggccacccctgaaagctctgcagcggccagcccgaggcgtattcgggcagagggg
gtaccagcctcagcctataggtctgtctcggagcccccaggctaccaggcacacagctgc
ctgtcccctggcgccctgcccaccctctgctgcgacacctgtcgccagctgcatgctgcc
cactgtgcagccctgcccgcctgccgtccaggccactcgctgcgtgtgctgcttggcgac
gcccagcggcgcttgtggctacagcgtgcacagatggacactctgctctacaacagcccc
ggggcccggccctag

KEGG   Homo sapiens (human): 9825
Entry
9825              CDS       T01001                                 
Symbol
SPATA2, PD1, PPP1R145, tamo
Name
(RefSeq) spermatogenesis associated 2
  KO
K17595  spermatogenesis-associated protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    9825 (SPATA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    9825 (SPATA2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     9825 (SPATA2)
SSDB
Motif
Pfam: PUB
Other DBs
NCBI-GeneID: 9825
NCBI-ProteinID: NP_001129245
OMIM: 607662
HGNC: 14681
Ensembl: ENSG00000158480
Vega: OTTHUMG00000032704
Pharos: Q9UM82(Tbio)
UniProt: Q9UM82 A8K0S9
Structure
LinkDB
Position
20:complement(49903391..49915529)
AA seq 520 aa
MGKPSSMDTKFKDDLFRKYVQFHESKVDTTTSRQRPGSDECLRVAASTLLSLHKVDPFYR
FRLIQFYEVVESSLRSLSSSSLRALHGAFSMLETVGINLFLYPWKKEFRSIKTYTGPFVY
YVKSTLLEEDIRAILSCMGYTPELGTAYKLRELVETLQVKMVSFELFLAKVECEQMLEIH
SQVKDKGYSELDIVSERKSSAEDVRGCSDALRRRAEGREHLTASMSRVALQKSASERAAK
DYYKPRVTKPSRSVDAYDSYWESRKPPLKASLSLRKEPVATDVGDDLKDEIIRPSPSLLT
MASSPHGSPDVLPPASPSNGPALLRGTYFSTQDDVDLYTDSEPRATYRRQDALRPDVWLL
RNDAHSLYHKRSPPAKESALSKCQSCGLSCSSSLCQRCDSLLTCPPASKPSAFPSKASTH
DSLAHGASLREKYPGQTQGLDRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSC
DACLSAYHYDPCYKKSELHKFMPNNQLNYKSTQLSHLVYR
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggggaagcccagttcaatggatactaaattcaaggatgacttatttcggaagtacgtg
cagttccatgagagcaaagtggataccaccaccagcaggcagcggcctggcagcgatgag
tgcctgcgggtggcagcctcaaccctgctcagcctgcacaaggtggatcccttttatcga
ttccggctgatccagttctatgaggtggtggagagctccttgcgctcgctcagctcctct
agcctgcgggctctgcacggcgccttcagcatgctggagacggtgggcatcaacctcttc
ctctacccgtggaagaaggaattcagaagcatcaagacctacacgggcccttttgtttat
tatgtcaagtcgacattactggaagaggacatccgagccatcctgagctgcatgggctac
acacctgagctgggcactgcatacaagctcagagagctcgtggagaccctccaggtgaag
atggtctcctttgagctctttctggccaaagtcgagtgtgagcagatgctagaaatccac
tcacaagtgaaggacaagggctactccgagctggacattgtgagcgagcgcaagagcagt
gcagaggatgtgcgcggctgctcggacgccctgcggcggcgggcagagggccgggagcac
ctgacggcctccatgtcacgagtggcactccagaagtcggccagcgagcgggcggccaag
gactactacaagccccgcgtgaccaagccctcgaggtcagtggatgcctatgacagctac
tgggagagccggaagccacccctgaaggcctcattgagtcttcggaaggagcctgtggca
acggatgtgggggacgacctcaaggatgagatcatccgcccatccccttcgctgctgacc
atggccagctccccccacggcagcccggatgtgcttccacccgcctcccccagcaacggc
ccggccctgctgcgcggtacctacttctccactcaggatgacgtggatctgtacacagac
tctgaacccagggccacctaccgtcggcaggatgctctgcggccggatgtgtggctgctc
agaaacgatgcccactccctctaccacaagcgctcgccccctgccaaagagtccgccctc
tccaagtgccaaagctgcgggctgtcctgcagctcctccctctgccagcgctgtgacagc
ctgctcacctgtcctccagcttccaagcccagcgccttccccagcaaggcctcgactcat
gacagcctggcccacggggcatctctgcgggagaagtacccaggccagactcagggcctc
gaccgcctcccgcaccttcactccaaatccaagccctccaccacgcccacttcccgctgt
ggcttctgcaaccgcccaggcgccaccaacacctgcacccagtgttcaaaagtctcatgt
gacgcctgcctcagcgcttaccattatgacccctgctacaaaaagagtgagctgcacaag
ttcatgcccaacaaccagctgaactacaagtccacccagctctcccatctcgtgtacaga
tag

DBGET integrated database retrieval system