KEGG   Homo sapiens (human): 1258
Entry
1258              CDS       T01001                                 

Symbol
CNGB1, CNCG2, CNCG3L, CNCG4, CNG4, CNGB1B, GAR1, GARP, GARP2, RCNC2, RCNCb, RCNCbeta, RP45
Name
(RefSeq) cyclic nucleotide gated channel subunit beta 1
  KO
K04952  cyclic nucleotide gated channel beta 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04740  Olfactory transduction
hsa04744  Phototransduction
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1258 (CNGB1)
   04022 cGMP-PKG signaling pathway
    1258 (CNGB1)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    1258 (CNGB1)
   04740 Olfactory transduction
    1258 (CNGB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1258 (CNGB1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   1258 (CNGB1)
SSDB
Motif
Pfam: cNMP_binding Npa1
Other DBs
NCBI-GeneID: 1258
NCBI-ProteinID: NP_001288
OMIM: 600724
HGNC: 2151
Ensembl: ENSG00000070729
Vega: OTTHUMG00000154810
Pharos: Q14028(Tbio)
UniProt: Q14028
LinkDB
Position
16q21
AA seq 1251 aa
MLGWVQRVLPQPPGTPRKTKMQEEEEVEPEPEMEAEVEPEPNPEEAETESESMPPEESFK
EEEVAVADPSPQETKEAALTSTISLRAQGAEISEMNSPSRRVLTWLMKGVEKVIPQPVHS
ITEDPAQILGHGSTGDTGCTDEPNEALEAQDTRPGLRLLLWLEQNLERVLPQPPKSSEVW
RDEPAVATGAASDPAPPGRPQEMGPKLQARETPSLPTPIPLQPKEEPKEAPAPEPQPGSQ
AQTSSLPPTRDPARLVAWVLHRLEMALPQPVLHGKIGEQEPDSPGICDVQTISILPGGQV
EPDLVLEEVEPPWEDAHQDVSTSPQGTEVVPAYEEENKAVEKMPRELSRIEEEKEDEEEE
EEEEEEEEEEEVTEVLLDSCVVSQVGVGQSEEDGTRPQSTSDQKLWEEVGEEAKKEAEEK
AKEEAEEVAEEEAEKEPQDWAETKEEPEAEAEAASSGVPATKQHPEVQVEDTDADSCPLM
AEENPPSTVLPPPSPAKSDTLIVPSSASGTHRKKLPSEDDEAEELKALSPAESPVVAWSD
PTTPKDTDGQDRAASTASTNSAIINDRLQELVKLFKERTEKVKEKLIDPDVTSDEESPKP
SPAKKAPEPAPDTKPAEAEPVEEEHYCDMLCCKFKHRPWKKYQFPQSIDPLTNLMYVLWL
FFVVMAWNWNCWLIPVRWAFPYQTPDNIHHWLLMDYLCDLIYFLDITVFQTRLQFVRGGD
IITDKKDMRNNYLKSRRFKMDLLSLLPLDFLYLKVGVNPLLRLPRCLKYMAFFEFNSRLE
SILSKAYVYRVIRTTAYLLYSLHLNSCLYYWASAYQGLGSTHWVYDGVGNSYIRCYYFAV
KTLITIGGLPDPKTLFEIVFQLLNYFTGVFAFSVMIGQMRDVVGAATAGQTYYRSCMDST
VKYMNFYKIPKSVQNRVKTWYEYTWHSQGMLDESELMVQLPDKMRLDLAIDVNYNIVSKV
ALFQGCDRQMIFDMLKRLRSVVYLPNDYVCKKGEIGREMYIIQAGQVQVLGGPDGKSVLV
TLKAGSVFGEISLLAVGGGNRRTANVVAHGFTNLFILDKKDLNEILVHYPESQKLLRKKA
RRMLRSNNKPKEEKSVLILPPRAGTPKLFNAALAMTGKMGGKGAKGGKLAHLRARLKELA
ALEAAAKQQELVEQAKSSQDVKGEEGSAAPDQHTHPKEAATDPPAPRTPPEPPGSPPSSP
PPASLGRPEGEEEGPAEPEEHSVRICMSPGPEPGEQILSVKMPEEREEKAE
NT seq 3756 nt   +upstreamnt  +downstreamnt
atgttgggctgggtccagagggtgctgcctcagcccccagggacccctcggaagaccaag
atgcaggaggaagaggaagtggaaccagagccagagatggaggcggaggtggaaccagaa
ccgaatcctgaggaggccgagacagagtccgagtccatgccccccgaagagtcattcaag
gaggaggaagtggctgtggcagacccaagccctcaggagaccaaggaggctgcccttact
tccaccatatccctccgggcccagggcgctgagatttctgaaatgaatagtcccagccgc
agggtactgacctggctcatgaagggcgtagagaaggtgatcccgcagcctgttcacagc
atcacggaggacccggctcagatcctggggcatggcagcactggggacacagggtgcaca
gatgaacccaatgaggcccttgaggcccaagacactaggcctgggctgcggctgcttctg
tggctggagcagaatctggaaagagtgcttcctcagccccccaaatcctctgaggtctgg
agagatgagcctgcagttgctacaggtgctgcctcagacccagcgcctccaggacgcccc
caggaaatggggcccaagctgcaggcccgggagaccccctccctgcccacacccatcccc
ctgcagcccaaggaggaacccaaggaggcaccagctccagagccccagcccggctcccag
gcccagacctcctccctgccaccaaccagggaccctgccaggctggtggcatgggtcctg
cacaggctggagatggccttgccgcagccagtgctacatgggaaaataggggaacaggag
cctgactcccctgggatatgtgatgtgcagaccatcagcatccttcctggaggacaagtg
gagcctgaccttgtcctagaggaggttgaaccgccctgggaggatgcccaccaggatgtc
agtaccagcccacagggtacagaggtggttccagcttatgaagaagagaacaaagctgtg
gagaagatgcccagagagctgtcccggattgaagaggagaaagaagatgaggaggaggaa
gaggaagaggaggaggaggaggaagaggaggaggtgactgaggtgctgctggatagctgt
gtggtgtcgcaggtgggcgtgggccagagtgaagaagacgggacccggccccagagcact
tcagatcagaagctgtgggaggaagttggggaggaggccaagaaggaggctgaagagaag
gccaaggaggaggccgaggaggtggctgaagaggaggctgaaaaggagccccaggactgg
gcggagaccaaggaggagcctgaggctgaggccgaggctgccagttcaggagtgcctgcc
acgaaacagcacccagaagtgcaggtggaagatactgatgctgatagctgccccctcatg
gcagaagagaatccaccctcaaccgtgttgccgccaccgtctcctgccaaatcagacacc
cttatagtcccaagctcagcctcggggacacacaggaagaagctgccctctgaggatgat
gaggctgaagagctcaaggcgttgtcaccagcagagtccccagtggttgcctggtctgac
cccaccaccccgaaggacactgatggccaggaccgtgcggcctccacggccagcacaaat
agcgccatcatcaacgaccggctccaggagctggtgaagctcttcaaggagcggacagag
aaagtgaaggagaaactcattgaccctgacgtcacctctgatgaggagagccccaagccc
tccccagccaagaaagccccagagccagctccagacacaaagcccgctgaagccgagcca
gtggaagaggagcactattgcgacatgctctgctgcaagttcaaacaccgcccctggaag
aagtaccagtttccccagagcattgacccgctgaccaacctgatgtatgtcctatggctg
ttcttcgtggtgatggcctggaattggaactgttggctgattcccgtgcgctgggccttc
ccctaccagaccccggacaacatccaccactggctgctgatggattacctatgcgacctc
atctacttcctggacatcaccgtgttccagacacgcctgcagtttgtcagaggcggggac
atcattacggacaaaaaggacatgcgaaataactacctgaagtctcgccgcttcaagatg
gacctgctcagcctcctgcccttggattttctctatttgaaagtcggtgtgaaccccctc
ctccgcctgccccgctgtttaaagtacatggccttcttcgagtttaacagccgcctggaa
tccatcctcagcaaagcctacgtgtacagggtcatcaggaccacagcctaccttctctac
agcctgcatttgaattcctgtctttattactgggcatcggcctatcagggcctcggctcc
actcactgggtttacgatggcgtgggaaacagttatattcgctgttactactttgctgtg
aagaccctcatcaccatcggggggctgcctgaccccaagacactctttgaaattgtcttc
cagctgctgaattatttcacgggcgtctttgctttctctgtgatgatcggacagatgaga
gatgtggtaggggccgccaccgccggacagacctactaccgcagctgcatggacagcacg
gtgaagtacatgaatttctacaagatccccaagtccgtgcagaaccgcgtcaagacctgg
tacgagtacacctggcactcgcaaggcatgctggatgagtcagagctgatggtgcagctt
ccagacaagatgcggctggacctcgccatcgacgtgaactacaacatcgttagcaaagtc
gcactctttcagggctgtgaccggcagatgatctttgacatgctgaagaggcttcgctct
gttgtctacctgcccaacgactatgtgtgcaagaagggggagatcggccgtgagatgtac
atcatccaggcagggcaagtgcaggtcttgggcggccctgatgggaaatctgtgctggtg
acgctgaaagctggatctgtgtttggagaaataagcttgctggctgttgggggcgggaac
cggcgcacggccaacgtggtggcgcacgggtttaccaacctcttcatcctggataagaag
gacctgaatgagattttggtgcattatcctgagtctcagaagttactccggaagaaagcc
aggcgcatgctgagaagcaacaataagcccaaggaggagaagagcgtgctgatccttcca
ccccgggcgggcaccccaaagctcttcaacgctgccctcgctatgacaggaaagatgggt
ggcaagggggcaaaaggcggcaaacttgctcacctccgggcccggctcaaagaactggcc
gcgctggaggcggctgcaaagcagcaagagttggtggaacaggccaagagctcgcaagac
gtcaagggagaggaaggctccgccgccccagaccagcacacgcacccaaaggaggccgcc
accgacccacccgcgccccggacgccccccgagcccccggggtctccaccgagctctcca
ccgcctgcctcccttgggaggccggagggagaggaggaggggccggccgagcccgaagag
cactcggtgaggatctgcatgagcccgggcccggagccgggagagcagatcctgtcggtg
aagatgccggaggaaagggaggagaaggcggagtaa

KEGG   Homo sapiens (human): 1259
Entry
1259              CDS       T01001                                 

Symbol
CNGA1, CNCG, CNCG1, CNG-1, CNG1, RCNC1, RCNCa, RCNCalpha, RP49
Name
(RefSeq) cyclic nucleotide gated channel subunit alpha 1
  KO
K04948  cyclic nucleotide gated channel alpha 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04744  Phototransduction
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1259 (CNGA1)
   04022 cGMP-PKG signaling pathway
    1259 (CNGA1)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    1259 (CNGA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1259 (CNGA1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   1259 (CNGA1)
SSDB
Motif
Pfam: Ion_trans CLZ cNMP_binding SpoIIIAH MCU DDHD Ion_trans_2 Zip Tim54 SLC12 Connexin NPR3 DUF4746 Presenilin RR_TM4-6 FancD2 Eapp_C Sec62 DUF2370 DUF2828
Other DBs
NCBI-GeneID: 1259
NCBI-ProteinID: NP_000078
OMIM: 123825
HGNC: 2148
Ensembl: ENSG00000198515
Vega: OTTHUMG00000160668
Pharos: P29973(Tbio)
UniProt: P29973 A0A024R9X3
LinkDB
Position
4p12
AA seq 686 aa
MKNNIINTQQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSASTSEESENENPHARG
SFSYKSLRKGGPSQREQYLPGAIALFNVNNSSNKDQEPEEKKKKKKEKKSKSDDKNENKN
DPEKKKKKKDKEKKKKEEKSKDKKEEEKKEVVVIDPSGNTYYNWLFCITLPVMYNWTMVI
ARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNL
QFKLDVLSLIPTDLLYFKLGWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRISNLV
MYIVIIIHWNACVFYSISKAIGFGNDTWVYPDINDPEFGRLARKYVYSLYWSTLTLTTIG
ETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFR
NVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCE
AGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYF
GEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILM
KDGLLDLNIANAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK
FLKPLIDTEFSSIEGPGAESGPIDST
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgaagaacaatattatcaatacacagcagtcttttgtaaccatgcccaatgtgattgta
ccagatattgaaaaggaaatacgaaggatggaaaatggagcatgcagctccttttctgag
gatgatgacagtgcctctacatctgaagaatcagagaatgaaaaccctcatgcaaggggt
tcctttagttataagtcactcagaaagggaggaccatcacagagggagcagtacctgcct
ggtgccattgcactttttaatgtgaacaacagcagcaataaggaccaggaaccagaagaa
aaaaagaaaaagaaaaaagaaaagaagagcaagtcagatgataaaaacgaaaataaaaac
gacccagagaagaaaaagaagaaaaaggacaaagagaagaaaaagaaagaggagaaaagc
aaagataagaaagaagaggagaagaaagaagttgtggttattgatccctcgggaaacaca
tattacaactggctgttttgcatcacattacctgttatgtacaactggacaatggttatt
gccagagcatgttttgatgaacttcaatctgattacctagaatattggctcattttggat
tacgtatcagacatagtctatttaatcgatatgtttgtacgaacaaggacaggttaccta
gaacaaggactgctggtaaaggaagaacttaaactcataaataaatataaatccaacttg
caatttaaacttgatgttctgtcactgataccaactgatttgctgtattttaagttaggg
tggaactatccagaaattagattaaacaggttgttacggttctctcgtatgtttgagttc
ttccagagaacagaaacaaggacaaactatccaaacatcttcaggatttccaaccttgtt
atgtatatcgtcatcattatccactggaatgcatgtgtgttctactctatttctaaagct
attggatttggaaatgatacatgggtctaccctgatattaatgatcctgaatttggccgt
ttggctagaaaatacgtatacagcctttactggtctacactgactttgactaccattggt
gaaacaccccctcccgtgagggattctgagtatgtctttgtggtggttgatttcctaatt
ggagtgttaatttttgctaccatcgttggtaacataggttctatgatttccaacatgaat
gcagccagagcagaatttcaagcaagaattgatgctatcaagcaatatatgcattttcga
aatgtaagcaaagatatggaaaagagggttattaaatggtttgactacctgtggaccaac
aaaaaaacagttgatgagaaagaagtcttaaagtatctacctgataaactaagagcagaa
attgccatcaacgttcacttagacacattaaaaaaggtacgcatttttgctgattgtgaa
gctggtctgttggtggagttggtcttgaaattgcaaccccaagtctacagtcctggagat
tatatttgcaagaaaggggatatcggacgagagatgtacattatcaaggaaggcaaactc
gctgtggtggcagatgatggagtcactcagtttgtggtattgagcgatggcagctacttc
ggtgagatcagcattcttaacattaaagggagcaaagctggcaatcgaagaacggccaat
attaaaagtattggctactcagacctgttctgtctctcaaaagatgacctcatggaagct
ctaactgagtacccagatgccaaaactatgctggaagagaaagggaagcagattttaatg
aaagatggtctactggatctaaacattgcaaatgctggcagtgatcctaaagatcttgaa
gagaaggttactcgaatggaggggtcagtagacctcctgcaaaccaggtttgcccgaatc
ttggctgagtatgagtccatgcagcagaaactgaaacaaagattaaccaaggttgagaaa
tttctgaaaccgcttattgacacagaattttcaagtattgagggacctggagcggaaagt
gggcccatcgactctacatag

KEGG   Homo sapiens (human): 1260
Entry
1260              CDS       T01001                                 

Symbol
CNGA2, CNCA, CNCA1, CNG2, OCNC1, OCNCALPHA, OCNCa
Name
(RefSeq) cyclic nucleotide gated channel subunit alpha 2
  KO
K04949  cyclic nucleotide gated channel alpha 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1260 (CNGA2)
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    1260 (CNGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1260 (CNGA2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   1260 (CNGA2)
SSDB
Motif
Pfam: Ion_trans CLZ cNMP_binding Ion_trans_2 Snapin_Pallidin
Other DBs
NCBI-GeneID: 1260
NCBI-ProteinID: NP_005131
OMIM: 300338
HGNC: 2149
Ensembl: ENSG00000183862
Vega: OTTHUMG00000024173
Pharos: Q16280(Tbio)
UniProt: Q16280 B3KXY3
LinkDB
Position
Xq28
AA seq 664 aa
MTEKTNGVKSSPANNHNHHAPPAIKANGKDDHRTSSRPHSAADDDTSSELQRLADVDAPQ
QGRSGFRRIVRLVGIIREWANKNFREEEPRPDSFLERFRGPELQTVTTQEGDGKGDKDGE
DKGTKKKFELFVLDPAGDWYYCWLFVIAMPVLYNWCLLVARACFSDLQKGYYLVWLVLDY
VSDVVYIADLFIRLRTGFLEQGLLVKDTKKLRDNYIHTLQFKLDVASIIPTDLIYFAVDI
HSPEVRFNRLLHFARMFEFFDRTETRTNYPNIFRISNLVLYILVIIHWNACIYYAISKSI
GFGVDTWVYPNITDPEYGYLAREYIYCLYWSTLTLTTIGETPPPVKDEEYLFVIFDFLIG
VLIFATIVGNVGSMISNMNATRAEFQAKIDAVKHYMQFRKVSKGMEAKVIRWFDYLWTNK
KTVDEREILKNLPAKLRAEIAINVHLSTLKKVRIFHDCEAGLLVELVLKLRPQVFSPGDY
ICRKGDIGKEMYIIKEGKLAVVADDGVTQYALLSAGSCFGEISILNIKGSKMGNRRTANI
RSLGYSDLFCLSKDDLMEAVTEYPDAKKVLEERGREILMKEGLLDENEVATSMEVDVQEK
LGQLETNMETLYTRFGRLLAEYTGAQQKLKQRITVLETKMKQNNEDDYLSDGMNSPELAA
ADEP
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgaccgaaaaaaccaatggtgtgaagagctccccagccaataatcacaaccatcatgca
cctcctgccatcaaggccaatggcaaagatgaccacaggacaagcagcaggccacactct
gcagctgacgatgacacctcctcagaactgcagaggctggcagacgtggatgccccacag
cagggaaggagtggcttccgcaggatagttcgcctggtggggatcatcagagaatgggcc
aacaagaatttccgagaggaggaacctaggcctgactcattcctcgagcgttttcgtggg
cctgaactccagactgtgaccacacaggagggggatggcaaaggcgacaaggatggcgag
gacaaaggcaccaagaagaaatttgaactatttgtcttggacccagctggggattggtac
tactgctggctatttgtcattgccatgcccgtcctttacaactggtgcctgctggtggcc
agagcctgcttcagtgacctacagaaaggctactacctggtgtggctggtgctggattat
gtctcagatgtggtctacattgcggacctcttcatccgattgcgcacaggtttcctggag
caggggctgctggtcaaagataccaagaaactgcgagacaactacatccacaccctgcag
ttcaagctggatgtggcttccatcatccccactgacctgatctattttgctgtggacatc
cacagccctgaggtgcgcttcaaccgcctgctgcactttgcccgcatgtttgagttcttt
gaccggacagagacacgcaccaactaccctaacatcttccgcatcagcaaccttgtcctc
tacatcttggtcatcatccactggaatgcctgcatctattatgccatctccaaatccata
ggctttggggtcgacacctgggtttacccaaacatcactgaccctgagtatggctacctg
gctagggaatacatctattgcctttactggtccacactgactctcactaccattggggag
acaccaccccctgtaaaggatgaggagtacctatttgtcatctttgacttcctgattggc
gtcctcatctttgccaccatcgtgggaaatgtgggctccatgatctccaacatgaatgcc
acccgggcagagttccaggctaagatcgatgccgtgaaacactacatgcagttccgaaag
gtcagcaaggggatggaagccaaggtcattaggtggtttgactacttgtggaccaataag
aagacagtggatgagcgagaaattctcaagaatctgccagccaagctcagggctgagata
gccatcaatgtccacttgtccacactcaagaaagtgcgcatcttccatgattgtgaggct
ggcctgctggtagagctggtactgaaactccgtcctcaggtcttcagtcctggggattac
atttgccgcaaaggggacatcggcaaggagatgtacatcattaaggagggcaaactggca
gtggtggctgatgatggtgtgactcagtatgctctgctgtcggctggaagctgctttggc
gagatcagtatccttaacattaagggcagtaaaatgggcaatcgacgcacagctaatatc
cgcagcctgggctactcagatctcttctgcttgtccaaggatgatcttatggaagctgtg
actgagtaccctgatgccaagaaagtcctagaagagaggggtcgggagatcctcatgaag
gagggactgctggatgagaacgaagtggcaaccagcatggaggtcgacgtgcaggagaag
ctagggcagctggagaccaacatggaaaccttgtacactcgctttggccgcctgctggct
gagtacacgggggcccagcagaagctcaagcagcgcatcacagttctggaaaccaagatg
aaacagaacaatgaagatgactacctgtctgatgggatgaacagccctgagctggctgct
gctgacgagccataa

KEGG   Homo sapiens (human): 1261
Entry
1261              CDS       T01001                                 

Symbol
CNGA3, ACHM2, CCNC1, CCNCa, CCNCalpha, CNCG3, CNG3
Name
(RefSeq) cyclic nucleotide gated channel subunit alpha 3
  KO
K04950  cyclic nucleotide gated channel alpha 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04740  Olfactory transduction
Disease
H00971  Achromatopsia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1261 (CNGA3)
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    1261 (CNGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1261 (CNGA3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   1261 (CNGA3)
SSDB
Motif
Pfam: CLZ Ion_trans cNMP_binding Ion_trans_2
Other DBs
NCBI-GeneID: 1261
NCBI-ProteinID: NP_001289
OMIM: 600053
HGNC: 2150
Ensembl: ENSG00000144191
Vega: OTTHUMG00000130561
Pharos: Q16281(Tbio)
UniProt: Q16281
LinkDB
Structure
PDB: 
3SWY

Position
2q11.2
AA seq 694 aa
MAKINTQYSHPSRTHLKVKTSDRDLNRAENGLSRAHSSSEETSSVLQPGIAMETRGLADS
GQGSFTGQGIARLSRLIFLLRRWAARHVHHQDQGPDSFPDRFRGAELKEVSSQESNAQAN
VGSQEPADRGRSAWPLAKCNTNTSNNTEEEKKTKKKDAIVVDPSSNLYYRWLTAIALPVF
YNWYLLICRACFDELQSEYLMLWLVLDYSADVLYVLDVLVRARTGFLEQGLMVSDTNRLW
QHYKTTTQFKLDVLSLVPTDLAYLKVGTNYPEVRFNRLLKFSRLFEFFDRTETRTNYPNM
FRIGNLVLYILIIIHWNACIYFAISKFIGFGTDSWVYPNISIPEHGRLSRKYIYSLYWST
LTLTTIGETPPPVKDEEYLFVVVDFLVGVLIFATIVGNVGSMISNMNASRAEFQAKIDSI
KQYMQFRKVTKDLETRVIRWFDYLWANKKTVDEKEVLKSLPDKLKAEIAINVHLDTLKKV
RIFQDCEAGLLVELVLKLRPTVFSPGDYICKKGDIGKEMYIINEGKLAVVADDGVTQFVV
LSDGSYFGEISILNIKGSKSGNRRTANIRSIGYSDLFCLSKDDLMEALTEYPEAKKALEE
KGRQILMKDNLIDEELARAGADPKDLEEKVEQLGSSLDTLQTRFARLLAEYNATQMKMKQ
RLSQLESQVKGGGDKPLADGEVPGDATKTEDKQQ
NT seq 2085 nt   +upstreamnt  +downstreamnt
atggccaagatcaacacccaatactcccacccctccaggacccacctcaaggtaaagacc
tcagaccgagatctcaatcgcgctgaaaatggcctcagcagagcccactcgtcaagtgag
gagacatcgtcagtgctgcagccggggatcgccatggagaccagaggactggctgactcc
gggcagggctccttcaccggccaggggatcgccaggctgtcgcgcctcatcttcttgctg
cgcaggtgggctgccaggcatgtgcaccaccaggaccagggaccggactcttttcctgat
cgtttccgtggagccgagcttaaggaggtgtccagccaagaaagcaatgcccaggcaaat
gtgggcagccaggagccagcagacagagggagaagcgcctggcccctggccaaatgcaac
actaacaccagcaacaacacggaggaggagaagaagacgaaaaagaaggatgcgatcgtg
gtggacccgtccagcaacctgtactaccgctggctgaccgccatcgccctgcctgtcttc
tataactggtatctgcttatttgcagggcctgtttcgatgagctgcagtccgagtacctg
atgctgtggctggtcctggactactcggcagatgtcctgtatgtcttggatgtgcttgta
cgagctcggacaggttttctcgagcaaggcttaatggtcagtgataccaacaggctgtgg
cagcattacaagacgaccacgcagttcaagctggatgtgttgtccctggtccccaccgac
ctggcttacttaaaggtgggcacaaactacccagaagtgaggttcaaccgcctactgaag
ttttcccggctctttgaattctttgaccgcacagagacaaggaccaactaccccaatatg
ttcaggattgggaacttggtcttgtacattctcatcatcatccactggaatgcctgcatc
tactttgccatttccaagttcattggttttgggacagactcctgggtctacccaaacatc
tcaatcccagagcatgggcgcctctccaggaagtacatttacagtctctactggtccacc
ttgacccttaccaccattggtgagaccccaccccccgtgaaagatgaggagtatctcttt
gtggtcgtagacttcttggtgggtgttctgatttttgccaccattgtgggcaatgtgggc
tccatgatctcgaatatgaatgcctcacgggcagagttccaggccaagattgattccatc
aagcagtacatgcagttccgcaaggtcaccaaggacttggagacgcgggttatccggtgg
tttgactacctgtgggccaacaagaagacggtggatgagaaggaggtgctcaagagcctc
ccagacaagctgaaggctgagatcgccatcaacgtgcacctggacacgctgaagaaggtt
cgcatcttccaggactgtgaggcagggctgctggtggagctggtgctgaagctgcgaccc
actgtgttcagccctggggattatatctgcaagaagggagatattgggaaggagatgtac
atcatcaacgagggcaagctggccgtggtggctgatgatggggtcacccagttcgtggtc
ctcagcgatggcagctacttcggggagatcagcattctgaacatcaaggggagcaagtcg
gggaaccgcaggacggccaacatccgcagcattggctactcagacctgttctgcctctca
aaggacgatctcatggaggccctcaccgagtaccccgaagccaagaaggccctggaggag
aaaggacggcagatcctgatgaaagacaacctgatcgatgaggagctggccagggcgggc
gcggaccccaaggaccttgaggagaaagtggagcagctggggtcctccctggacaccctg
cagaccaggtttgcacgcctcctggctgagtacaacgccacccagatgaagatgaagcag
cgtctcagccaactggaaagccaggtgaagggtggtggggacaagcccctggctgatggg
gaagttcccggggatgctacaaaaacagaggacaaacaacagtga

KEGG   Homo sapiens (human): 1262
Entry
1262              CDS       T01001                                 

Symbol
CNGA4, CNCA2, CNG-4, CNG4, CNG5, CNGB2, OCNC2, OCNCBETA, OCNCb
Name
(RefSeq) cyclic nucleotide gated channel subunit alpha 4
  KO
K04951  cyclic nucleotide gated channel alpha 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1262 (CNGA4)
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    1262 (CNGA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1262 (CNGA4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   1262 (CNGA4)
SSDB
Motif
Pfam: Ion_trans CLZ cNMP_binding
Other DBs
NCBI-GeneID: 1262
NCBI-ProteinID: NP_001032406
OMIM: 609472
HGNC: 2152
Ensembl: ENSG00000132259
Vega: OTTHUMG00000165379
Pharos: Q8IV77(Tdark)
UniProt: Q8IV77
LinkDB
Position
11p15.4
AA seq 575 aa
MSQDTKVKTTESSPPAPSKARKLLPVLDPSGDYYYWWLNTMVFPVMYNLIILVCRACFPD
LQHGYLVAWLVLDYTSDLLYLLDMVVRFHTGFLEQGILVVDKGRISSRYVRTWSFFLDLA
SLMPTDVVYVRLGPHTPTLRLNRFLRAPRLFEAFDRTETRTAYPNAFRIAKLMLYIFVVI
HWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQYLYSFYFSTLILTTVGDTPPPAR
EEEYLFMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLQHVNRKLE
RRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQNCEASLLEEL
VLKLQPQTYSPGEYVCRKGDIGQEMYIIREGQLAVVADDGITQYAVLGAGLYFGEISIIN
IKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQAQTIMEEKGREILLKMNKLDV
NAEAAEIALQEATESRLRGLDQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWP
MPEDLAEADDEGEPEEGTSKDEEGRASQEGPPGPE
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgagccaggacaccaaagtgaagacaacagagtccagtcccccagccccatccaaggcc
aggaagttgctgcctgtcctggacccatctggggattactactactggtggctgaacaca
atggtcttcccagtcatgtataacctcatcatcctcgtgtgcagagcctgcttccccgac
ttgcagcacggttatctggtggcctggttggtgctggactacacgagtgacctgctatac
ctactagacatggtggtgcgcttccacacaggattcttggaacagggcatcctggtggtg
gacaagggtaggatctcgagtcgctacgttcgcacctggagtttcttcttggacctggct
tccctgatgcccacagatgtggtctacgtgcggctgggcccgcacacacccaccctgagg
ctgaaccgctttctccgcgcgccccgcctcttcgaggccttcgaccgcacagagacccgc
acagcttacccaaatgcctttcgcattgccaagctgatgctttacatttttgtcgtcatc
cattggaacagctgcctatactttgccctatcccggtacctgggcttcgggcgtgacgca
tgggtgtacccggaccccgcgcagcctggctttgagcgcctgcggcgccagtacctctat
agcttttacttctccacgctgatactgactacagtgggcgatacaccgccgccagccagg
gaagaagagtacctcttcatggtgggcgacttcctgctggccgtcatgggtttcgccacc
atcatgggtagcatgagctctgtcatctacaacatgaacactgcagatgcggctttctac
ccagatcatgcactggtgaagaagtacatgaagctgcagcacgtcaaccgcaagctggag
cggcgagttattgactggtatcagcacctgcagatcaacaagaagatgaccaacgaggta
gccatcttacagcacttgcctgagcggctgcgggcagaagtggctgtgtctgtgcacctg
tccactctgagccgggtgcagatctttcagaactgtgaggccagcctgctggaggagctg
gtgctgaagctgcagccccagacctactcaccaggtgaatatgtatgccgcaaaggagac
attggccaagagatgtacatcatccgagagggtcaactggccgtggtggcagatgatggt
atcacacagtatgctgtgctcggtgcagggctctactttggggagatcagcatcatcaac
atcaaagggaacatgtctgggaaccgccgcacagccaacatcaagagcctaggttattca
gacctattctgcctgagcaaggaggacctgcgggaggtgctgagcgagtatccacaagca
cagaccatcatggaggagaaaggacgtgagatcctgctgaaaatgaacaagttggacgtg
aatgctgaggcagctgagatcgccctgcaggaggccacagagtcccggctacgaggccta
gaccagcagctggatgatctacagaccaagtttgctcgcctcctggctgagctggagtcc
agcgcacttaagattgcttaccgcattgaacggctggagtggcagactcgagagtggcca
atgcccgaggacctggctgaggctgatgacgagggtgagcctgaggagggaacttccaaa
gatgaagagggcagggccagccaggagggacccccaggtccagagtga

KEGG   Homo sapiens (human): 54714
Entry
54714             CDS       T01001                                 

Symbol
CNGB3, ACHM1, ACHM3, RMCH
Name
(RefSeq) cyclic nucleotide gated channel subunit beta 3
  KO
K04953  cyclic nucleotide gated channel beta 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
Disease
H00819  Stargardt disease
H00971  Achromatopsia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    54714 (CNGB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    54714 (CNGB3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   54714 (CNGB3)
SSDB
Motif
Pfam: cNMP_binding
Other DBs
NCBI-GeneID: 54714
NCBI-ProteinID: NP_061971
OMIM: 605080
HGNC: 2153
Ensembl: ENSG00000170289
Vega: OTTHUMG00000163738
Pharos: Q9NQW8(Tbio)
UniProt: Q9NQW8
LinkDB
Position
8q21.3
AA seq 809 aa
MFKSLTKVNKVKPIGENNENEQSSRRNEEGSHPSNQSQQTTAQEENKGEEKSLKTKSTPV
TSEEPHTNIQDKLSKKNSSGDLTTNPDPQNAAEPTGTVPEQKEMDPGKEGPNSPQNKPPA
APVINEYADAQLHNLVKRMRQRTALYKKKLVEGDLSSPEASPQTAKPTAVPPVKESDDKP
TEHYYRLLWFKVKKMPLTEYLKRIKLPNSIDSYTDRLYLLWLLLVTLAYNWNCCFIPLRL
VFPYQTADNIHYWLIADIICDIIYLYDMLFIQPRLQFVRGGDIIVDSNELRKHYRTSTKF
QLDVASIIPFDICYLFFGFNPMFRANRMLKYTSFFEFNHHLESIMDKAYIYRVIRTTGYL
LFILHINACVYYWASNYEGIGTTRWVYDGEGNEYLRCYYWAVRTLITIGGLPEPQTLFEI
VFQLLNFFSGVFVFSSLIGQMRDVIGAATANQNYFRACMDDTIAYMNNYSIPKLVQKRVR
TWYEYTWDSQRMLDESDLLKTLPTTVQLALAIDVNFSIISKVDLFKGCDTQMIYDMLLRL
KSVLYLPGDFVCKKGEIGKEMYIIKHGEVQVLGGPDGTKVLVTLKAGSVFGEISLLAAGG
GNRRTANVVAHGFANLLTLDKKTLQEILVHYPDSERILMKKARVLLKQKAKTAEATPPRK
DLALLFPPKEETPKLFKTLLGGTGKASLARLLKLKREQAAQKKENSEGGEEEGKENEDKQ
KENEDKQKENEDKGKENEDKDKGREPEEKPLDRPECTASPIAVEEEPHSVRRTVLPRGTS
RQSLIISMAPSAEGGEEVLTIEVKEKAKQ
NT seq 2430 nt   +upstreamnt  +downstreamnt
atgtttaaatcgctgacaaaagtcaacaaggtgaagcctataggagagaacaatgagaat
gaacaaagttctcgtcggaatgaagaaggctctcacccaagtaatcagtctcagcaaacc
acagcacaggaagaaaacaaaggtgaagagaaatctctcaaaaccaagtcaactccagtc
acgtctgaagagccacacaccaacatacaagacaaactctccaagaaaaattcctctgga
gatctgaccacaaaccctgaccctcaaaatgcagcagaaccaactggaacagtgccagag
cagaaggaaatggaccccgggaaagaaggtccaaacagcccacaaaacaaaccgcctgca
gctcctgttataaatgagtatgccgatgcccagctacacaacctggtgaaaagaatgcgt
caaagaacagccctctacaagaaaaagttggtagagggagatctctcctcacccgaagcc
agcccacaaactgcaaagcccacggctgtaccaccagtaaaagaaagcgatgataagcca
acagaacattactacaggctgttgtggttcaaagtcaaaaagatgcctttaacagagtac
ttaaagcgaattaaacttccaaacagcatagattcatacacagatcgactctatctcctg
tggctcttgcttgtcactcttgcctataactggaactgctgttttataccactgcgcctc
gtcttcccatatcaaaccgcagacaacatacactactggcttattgcggacatcatatgt
gatatcatctacctttatgatatgctatttatccagcccagactccagtttgtaagagga
ggagacataatagtggattcaaatgagctaaggaaacactacaggacttctacaaaattt
cagttggatgtcgcatcaataataccatttgatatttgctacctcttctttgggtttaat
ccaatgtttagagcaaataggatgttaaagtacacttcattttttgaatttaatcatcac
ctagagtctataatggacaaagcatatatctacagagttattcgaacaactggatacttg
ctgtttattctgcacattaatgcctgtgtttattactgggcttcaaactatgaaggaatt
ggcactactagatgggtgtatgatggggaaggaaacgagtatctgagatgttattattgg
gcagttcgaactttaattaccattggtggccttccagaaccacaaactttatttgaaatt
gtttttcaactcttgaattttttttctggagtttttgtgttctccagtttaattggtcag
atgagagatgtgattggagcagctacagccaatcagaactacttccgcgcctgcatggat
gacaccattgcctacatgaacaattactccattcctaaacttgtgcaaaagcgagttcgg
acttggtatgaatatacatgggactctcaaagaatgctagatgagtctgatttgcttaag
accctaccaactacggtccagttagccctcgccattgatgtgaacttcagcatcatcagc
aaagtcgacttgttcaagggttgtgatacacagatgatttatgacatgttgctaagattg
aaatccgttctctatttgcctggtgactttgtctgcaaaaagggagaaattggcaaggaa
atgtatatcatcaagcatggagaagtccaagttcttggaggccctgatggtactaaagtt
ctggttactctgaaagctgggtcggtgtttggagaaatcagccttctagcagcaggagga
ggaaaccgtcgaactgccaatgtggtggcccacgggtttgccaatcttttaactctagac
aaaaagaccctccaagaaattctagtgcattatccagattctgaaaggatcctcatgaag
aaagccagagtgcttttaaagcagaaggctaagaccgcagaagcaacccctccaagaaaa
gatcttgccctcctcttcccaccgaaagaagagacacccaaactgtttaaaactctccta
ggaggcacaggaaaagcaagtcttgcaagactactcaaattgaagcgagagcaagcagct
cagaagaaagaaaattctgaaggaggagaggaagaaggaaaagaaaatgaagataaacaa
aaagaaaatgaagataaacaaaaagaaaatgaagataaaggaaaagaaaatgaagataaa
gataaaggaagagagccagaagagaagccactggacagacctgaatgtacagcaagtcct
attgcagtggaggaagaaccccactcagttagaaggacagttttacccagagggacttct
cgtcaatcactcattatcagcatggctccttctgctgagggcggagaagaggttcttact
attgaagtcaaagaaaaggctaagcaataa

DBGET integrated database retrieval system