KEGG   Homo sapiens (human): 1259
Entry
1259              CDS       T01001                                 

Gene name
CNGA1, CNCG, CNCG1, CNG-1, CNG1, RCNC1, RCNCa, RCNCalpha, RP49
Definition
(RefSeq) cyclic nucleotide gated channel subunit alpha 1
  KO
K04948  cyclic nucleotide gated channel alpha 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04744  Phototransduction
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    1259 (CNGA1)
   04022 cGMP-PKG signaling pathway
    1259 (CNGA1)
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    1259 (CNGA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    1259 (CNGA1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   1259 (CNGA1)
SSDB
Motif
Pfam: Ion_trans CLZ cNMP_binding SpoIIIAH MCU DDHD Ion_trans_2 Zip Tim54 SLC12 Connexin NPR3 DUF4746 Presenilin RR_TM4-6 FancD2 Eapp_C Sec62 DUF2370 DUF2828
Other DBs
NCBI-GeneID: 1259
NCBI-ProteinID: NP_000078
OMIM: 123825
HGNC: 2148
Ensembl: ENSG00000198515
Vega: OTTHUMG00000160668
Pharos: P29973(Tbio)
UniProt: P29973 A0A024R9X3
LinkDB
Position
4p12
AA seq 686 aa
MKNNIINTQQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSASTSEESENENPHARG
SFSYKSLRKGGPSQREQYLPGAIALFNVNNSSNKDQEPEEKKKKKKEKKSKSDDKNENKN
DPEKKKKKKDKEKKKKEEKSKDKKEEEKKEVVVIDPSGNTYYNWLFCITLPVMYNWTMVI
ARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKYKSNL
QFKLDVLSLIPTDLLYFKLGWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRISNLV
MYIVIIIHWNACVFYSISKAIGFGNDTWVYPDINDPEFGRLARKYVYSLYWSTLTLTTIG
ETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYMHFR
NVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFADCE
AGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDGSYF
GEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGKQILM
KDGLLDLNIANAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTKVEK
FLKPLIDTEFSSIEGPGAESGPIDST
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgaagaacaatattatcaatacacagcagtcttttgtaaccatgcccaatgtgattgta
ccagatattgaaaaggaaatacgaaggatggaaaatggagcatgcagctccttttctgag
gatgatgacagtgcctctacatctgaagaatcagagaatgaaaaccctcatgcaaggggt
tcctttagttataagtcactcagaaagggaggaccatcacagagggagcagtacctgcct
ggtgccattgcactttttaatgtgaacaacagcagcaataaggaccaggaaccagaagaa
aaaaagaaaaagaaaaaagaaaagaagagcaagtcagatgataaaaacgaaaataaaaac
gacccagagaagaaaaagaagaaaaaggacaaagagaagaaaaagaaagaggagaaaagc
aaagataagaaagaagaggagaagaaagaagttgtggttattgatccctcgggaaacaca
tattacaactggctgttttgcatcacattacctgttatgtacaactggacaatggttatt
gccagagcatgttttgatgaacttcaatctgattacctagaatattggctcattttggat
tacgtatcagacatagtctatttaatcgatatgtttgtacgaacaaggacaggttaccta
gaacaaggactgctggtaaaggaagaacttaaactcataaataaatataaatccaacttg
caatttaaacttgatgttctgtcactgataccaactgatttgctgtattttaagttaggg
tggaactatccagaaattagattaaacaggttgttacggttctctcgtatgtttgagttc
ttccagagaacagaaacaaggacaaactatccaaacatcttcaggatttccaaccttgtt
atgtatatcgtcatcattatccactggaatgcatgtgtgttctactctatttctaaagct
attggatttggaaatgatacatgggtctaccctgatattaatgatcctgaatttggccgt
ttggctagaaaatacgtatacagcctttactggtctacactgactttgactaccattggt
gaaacaccccctcccgtgagggattctgagtatgtctttgtggtggttgatttcctaatt
ggagtgttaatttttgctaccatcgttggtaacataggttctatgatttccaacatgaat
gcagccagagcagaatttcaagcaagaattgatgctatcaagcaatatatgcattttcga
aatgtaagcaaagatatggaaaagagggttattaaatggtttgactacctgtggaccaac
aaaaaaacagttgatgagaaagaagtcttaaagtatctacctgataaactaagagcagaa
attgccatcaacgttcacttagacacattaaaaaaggtacgcatttttgctgattgtgaa
gctggtctgttggtggagttggtcttgaaattgcaaccccaagtctacagtcctggagat
tatatttgcaagaaaggggatatcggacgagagatgtacattatcaaggaaggcaaactc
gctgtggtggcagatgatggagtcactcagtttgtggtattgagcgatggcagctacttc
ggtgagatcagcattcttaacattaaagggagcaaagctggcaatcgaagaacggccaat
attaaaagtattggctactcagacctgttctgtctctcaaaagatgacctcatggaagct
ctaactgagtacccagatgccaaaactatgctggaagagaaagggaagcagattttaatg
aaagatggtctactggatctaaacattgcaaatgctggcagtgatcctaaagatcttgaa
gagaaggttactcgaatggaggggtcagtagacctcctgcaaaccaggtttgcccgaatc
ttggctgagtatgagtccatgcagcagaaactgaaacaaagattaaccaaggttgagaaa
tttctgaaaccgcttattgacacagaattttcaagtattgagggacctggagcggaaagt
gggcccatcgactctacatag

DBGET integrated database retrieval system