KEGG   Homo sapiens (human): 1270
Entry
1270              CDS       T01001                                 
Symbol
CNTF, HCNTF
Name
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Network
nt06518  JAK-STAT signaling
  Element
N01556  IL6 family to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1270 (CNTF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1270 (CNTF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1270 (CNTF)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1270 (CNTF)
SSDB
Motif
Pfam: CNTF DUF3719
Other DBs
NCBI-GeneID: 1270
NCBI-ProteinID: NP_000605
OMIM: 118945
HGNC: 2169
Ensembl: ENSG00000242689
Pharos: P26441(Tbio)
UniProt: P26441
Structure
LinkDB
Position
11:58622665..58625733
AA seq 200 aa
MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVAS
TDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFA
YQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFIS
SHQTGIPARGSHYIANNKKM
NT seq 603 nt   +upstreamnt  +downstreamnt
atggctttcacagagcattcaccgctgacccctcaccgtcgggacctctgtagccgctct
atctggctagcaaggaagattcgttcagacctgactgctcttacggaatcctatgtgaag
catcagggcctgaacaagaacatcaacctggactctgcggatgggatgccagtggcaagc
actgatcagtggagtgagctgaccgaggcagagcgactccaagagaaccttcaagcttat
cgtaccttccatgttttgttggccaggctcttagaagaccagcaggtgcattttacccca
accgaaggtgacttccatcaagctatacatacccttcttctccaagtcgctgcctttgca
taccagatagaggagttaatgatactcctggaatacaagatcccccgcaatgaggctgat
gggatgcctattaatgttggagatggtggtctctttgagaagaagctgtggggcctaaag
gtgctgcaggagctttcacagtggacagtaaggtccatccatgaccttcgtttcatttct
tctcatcagactgggatcccagcacgtgggagccattatattgctaacaacaagaaaatg
tag

KEGG   Homo sapiens (human): 1489
Entry
1489              CDS       T01001                                 
Symbol
CTF1, CT-1, CT1
Name
(RefSeq) cardiotrophin 1
  KO
K05422  cardiotrophin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Network
nt06518  JAK-STAT signaling
  Element
N01556  IL6 family to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1489 (CTF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1489 (CTF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1489 (CTF1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1489 (CTF1)
SSDB
Motif
Pfam: LIF_OSM pPIWI_RE_X NolB PRF
Other DBs
NCBI-GeneID: 1489
NCBI-ProteinID: NP_001321
OMIM: 600435
HGNC: 2499
Ensembl: ENSG00000150281
Pharos: Q16619(Tbio)
UniProt: Q16619
LinkDB
Position
16:30895846..30903560
AA seq 201 aa
MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPS
FSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLR
RLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGL
YREWLSRTEGDLGQLLPGGSA
NT seq 606 nt   +upstreamnt  +downstreamnt
atgagccggagggagggaagtctggaagacccccagactgattcctcagtctcacttctt
ccccacttggaggccaagatccgtcagacacacagccttgcgcacctcctcaccaaatac
gctgagcagctgctccaggaatatgtgcagctccagggagaccccttcgggctgcccagc
ttctcgccgccgcggctgccggtggccggcctgagcgccccggctccgagccacgcgggg
ctgccagtgcacgagcggctgcggctggacgcggcggcgctggccgcgctgcccccgctg
ctggacgcagtgtgtcgccgccaggccgagctgaacccgcgcgcgccgcgcctgctgcgc
cgcctggaggacgcggcgcgccaggcccgggccctgggcgccgccgtggaggccttgctg
gccgcgctgggcgccgccaaccgcgggccccgggccgagccccccgccgccaccgcctca
gccgcctccgccaccggggtcttccccgccaaggtgctggggctccgcgtttgcggcctc
taccgcgagtggctgagccgcaccgagggcgacctgggccagctgctgcccgggggctcg
gcctga

KEGG   Homo sapiens (human): 23529
Entry
23529             CDS       T01001                                 
Symbol
CLCF1, BSF-3, BSF3, CISS2, CLC, NNT-1, NNT1, NR6
Name
(RefSeq) cardiotrophin like cytokine factor 1
  KO
K05421  cardiotrophin-like cytokine factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Network
nt06518  JAK-STAT signaling
  Element
N01556  IL6 family to Jak-STAT signaling pathway
Disease
H00935  Cold-induced sweating syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    23529 (CLCF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    23529 (CLCF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    23529 (CLCF1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   23529 (CLCF1)
SSDB
Motif
Pfam: PRF CNTF
Other DBs
NCBI-GeneID: 23529
NCBI-ProteinID: NP_037378
OMIM: 607672
HGNC: 17412
Ensembl: ENSG00000175505
Pharos: Q9UBD9(Tbio)
UniProt: Q9UBD9
LinkDB
Position
11:complement(67364168..67374177)
AA seq 225 aa
MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGT
YLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGL
NRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQ
KMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
NT seq 678 nt   +upstreamnt  +downstreamnt
atggacctccgagcaggggactcgtgggggatgttagcgtgcctgtgcacggtgctctgg
cacctccctgcagtgccagctctcaatcgcacaggggacccagggcctggcccctccatc
cagaaaacctatgacctcacccgctacctggagcaccaactccgcagcttggctgggacc
tatctgaactacctgggcccccctttcaacgagccagacttcaaccctccccgcctgggg
gcagagactctgcccagggccactgttgacttggaggtgtggcgaagcctcaatgacaaa
ctgcggctgacccagaactacgaggcctacagccaccttctgtgttacttgcgtggcctc
aaccgtcaggctgccactgctgagctgcgccgcagcctggcccacttctgcaccagcctc
cagggcctgctgggcagcattgcgggcgtcatggcagctctgggctacccactgccccag
ccgctgcctgggactgaacccacttggactcctggccctgcccacagtgacttcctccag
aagatggacgacttctggctgctgaaggagctgcagacctggctgtggcgctcggccaag
gacttcaaccggctcaagaagaagatgcagcctccagcagctgcagtcaccctgcacctg
ggggctcatggcttctga

KEGG   Homo sapiens (human): 246778
Entry
246778            CDS       T01001                                 
Symbol
IL27, IL-27, IL-27A, IL27A, IL27p28, IL30, p28
Name
(RefSeq) interleukin 27
  KO
K22629  interleukin 27 subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
hsa04659  Th17 cell differentiation
Network
nt06518  JAK-STAT signaling
  Element
N01556  IL6 family to Jak-STAT signaling pathway
N01559  Type II interferon to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    246778 (IL27)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    246778 (IL27)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    246778 (IL27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    246778 (IL27)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   246778 (IL27)
SSDB
Other DBs
NCBI-GeneID: 246778
NCBI-ProteinID: NP_663634
OMIM: 608273
HGNC: 19157
Ensembl: ENSG00000197272
Pharos: Q8NEV9(Tbio)
UniProt: Q8NEV9
Structure
LinkDB
Position
16:complement(28499362..28506834)
AA seq 243 aa
MGQTAGDLGWRLSLLLLPLLLVQAGVWGFPRPPGRPQLSLQELRREFTVSLHLARKLLSE
VRGQAHRFAESHLPGVNLYLLPLGEQLPDVSLTFQAWRRLSDPERLCFISTTLQPFHALL
GGLGTQGRWTNMERMQLWAMRLDLRDLQRHLRFQVLAAGFNLPEEEEEEEEEEEEERKGL
LPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLS
PQP
NT seq 732 nt   +upstreamnt  +downstreamnt
atgggccagacggcaggcgaccttggctggcggctcagcctgttgctgcttcccttgctc
ctggttcaagctggtgtctggggattcccaaggcccccagggaggccccagctgagcctg
caggagctgcggagggagttcacagtcagcctgcatctcgccaggaagctgctctccgag
gttcggggccaggcccaccgctttgcggaatctcacctgccaggagtgaacctgtacctc
ctgcccctgggagagcagctccctgatgtttccctgaccttccaggcctggcgccgcctc
tctgacccggagcgtctctgcttcatctccaccacgcttcagcccttccatgccctgctg
ggagggctggggacccagggccgctggaccaacatggagaggatgcagctgtgggccatg
aggctggacctccgcgatctgcagcggcacctccgcttccaggtgctggctgcaggattc
aacctcccggaggaggaggaggaggaagaggaggaggaggaggaggagaggaaggggctg
ctcccaggggcactgggcagcgccttacagggcccggcccaggtgtcctggccccagctc
ctctccacctaccgcctgctgcactccttggagctcgtcttatctcgggccgtgcgggag
ttgctgctgctgtccaaggctgggcactcagtctggcccttggggttcccaacattgagc
ccccagccctga

KEGG   Homo sapiens (human): 3569
Entry
3569              CDS       T01001                                 
Symbol
IL6, BSF-2, BSF2, CDF, HGF, HSF, IFN-beta-2, IFNB2, IL-6
Name
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01523  Antifolate resistance
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04657  IL-17 signaling pathway
hsa04659  Th17 cell differentiation
hsa04668  TNF signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04936  Alcoholic liver disease
hsa05010  Alzheimer disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05142  Chagas disease
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05321  Inflammatory bowel disease
hsa05323  Rheumatoid arthritis
hsa05332  Graft-versus-host disease
hsa05410  Hypertrophic cardiomyopathy
hsa05417  Lipid and atherosclerosis
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06219  JAK-STAT signaling
nt06224  CXCR signaling
nt06227  Nuclear receptor signaling
nt06240  Transcription
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06360  Cushing syndrome
nt06417  AGE-RAGE signaling
nt06460  Alzheimer disease
nt06517  TLR signaling
nt06518  JAK-STAT signaling
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00139  FUS-DDIT3 fusion to CEBPB-mediated transcription
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00317  AhR signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
N00435  TLR1/2/4-NFKB signaling pathway
N00994  AGE-RAGE signaling pathway
N00996  Mutation-caused aberrant Abeta to AGE-RAGE signaling pathway
N01266  IL6 to IL6R signaling
N01306  AngII-AT1R-NOX2 signaling pathway
N01307  SARS-CoV-2 S to AngII-AT1R-NOX2 signaling pathway
N01556  IL6 family to Jak-STAT signaling pathway
N01566  TLR5-NFKB signaling pathway
Disease
H00084  Graft-versus-host disease
H00630  Rheumatoid arthritis
H01479  Castleman disease
H01672  Juvenile idiopathic arthritis
Drug target
Olokizumab: D12487
Pirfenidone: D01583<JP/US>
Pomalidomide: D08976<JP/US>
Siltuximab: D09669<US>
Sirukumab: D10080
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3569 (IL6)
   04668 TNF signaling pathway
    3569 (IL6)
   04066 HIF-1 signaling pathway
    3569 (IL6)
   04068 FoxO signaling pathway
    3569 (IL6)
   04151 PI3K-Akt signaling pathway
    3569 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3569 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3569 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3569 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3569 (IL6)
   04620 Toll-like receptor signaling pathway
    3569 (IL6)
   04621 NOD-like receptor signaling pathway
    3569 (IL6)
   04623 Cytosolic DNA-sensing pathway
    3569 (IL6)
   04625 C-type lectin receptor signaling pathway
    3569 (IL6)
   04659 Th17 cell differentiation
    3569 (IL6)
   04657 IL-17 signaling pathway
    3569 (IL6)
   04672 Intestinal immune network for IgA production
    3569 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3569 (IL6)
   05202 Transcriptional misregulation in cancer
    3569 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3569 (IL6)
   05161 Hepatitis B
    3569 (IL6)
   05171 Coronavirus disease - COVID-19
    3569 (IL6)
   05164 Influenza A
    3569 (IL6)
   05162 Measles
    3569 (IL6)
   05168 Herpes simplex virus 1 infection
    3569 (IL6)
   05163 Human cytomegalovirus infection
    3569 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3569 (IL6)
   05169 Epstein-Barr virus infection
    3569 (IL6)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    3569 (IL6)
   05132 Salmonella infection
    3569 (IL6)
   05135 Yersinia infection
    3569 (IL6)
   05133 Pertussis
    3569 (IL6)
   05134 Legionellosis
    3569 (IL6)
   05152 Tuberculosis
    3569 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3569 (IL6)
   05144 Malaria
    3569 (IL6)
   05142 Chagas disease
    3569 (IL6)
   05143 African trypanosomiasis
    3569 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    3569 (IL6)
   05321 Inflammatory bowel disease
    3569 (IL6)
   05332 Graft-versus-host disease
    3569 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    3569 (IL6)
   05020 Prion disease
    3569 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    3569 (IL6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3569 (IL6)
   05410 Hypertrophic cardiomyopathy
    3569 (IL6)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3569 (IL6)
   04932 Non-alcoholic fatty liver disease
    3569 (IL6)
   04931 Insulin resistance
    3569 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    3569 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    3569 (IL6)
   01523 Antifolate resistance
    3569 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3569 (IL6)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3569 (IL6)
SSDB
Motif
Pfam: IL6 IL11 IL23 Phage_int_SAM_1 GCSF
Other DBs
NCBI-GeneID: 3569
NCBI-ProteinID: NP_000591
OMIM: 147620
HGNC: 6018
Ensembl: ENSG00000136244
Pharos: P05231(Tclin)
UniProt: P05231 Q75MH2 B4DVM1
Structure
LinkDB
Position
7:22727200..22731998
AA seq 212 aa
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaactccttctccacaagcgccttcggtccagttgccttctccctggggctgctcctg
gtgttgcctgctgccttccctgccccagtacccccaggagaagattccaaagatgtagcc
gccccacacagacagccactcacctcttcagaacgaattgacaaacaaattcggtacatc
ctcgacggcatctcagccctgagaaaggagacatgtaacaagagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggctgaaaaagatgga
tgcttccaatctggattcaatgaggagacttgcctggtgaaaatcatcactggtcttttg
gagtttgaggtatacctagagtacctccagaacagatttgagagtagtgaggaacaagcc
agagctgtgcagatgagtacaaaagtcctgatccagttcctgcagaaaaaggcaaagaat
ctagatgcaataaccacccctgacccaaccacaaatgccagcctgctgacgaagctgcag
gcacagaaccagtggctgcaggacatgacaactcatctcattctgcgcagctttaaggag
ttcctgcagtccagcctgagggctcttcggcaaatgtag

KEGG   Homo sapiens (human): 3589
Entry
3589              CDS       T01001                                 
Symbol
IL11, AGIF, IL-11
Name
(RefSeq) interleukin 11
  KO
K05417  interleukin 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05323  Rheumatoid arthritis
Network
nt06518  JAK-STAT signaling
  Element
N01556  IL6 family to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3589 (IL11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3589 (IL11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3589 (IL11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    3589 (IL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3589 (IL11)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3589 (IL11)
SSDB
Motif
Pfam: IL11
Other DBs
NCBI-GeneID: 3589
NCBI-ProteinID: NP_000632
OMIM: 147681
HGNC: 5966
Ensembl: ENSG00000095752
Pharos: P20809(Tbio)
UniProt: P20809 A8K3F7
Structure
LinkDB
Position
19:complement(55364382..55370463)
AA seq 199 aa
MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQL
RDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLK
TLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGG
LHLTLDWAVRGLLLLKTRL
NT seq 600 nt   +upstreamnt  +downstreamnt
atgaactgtgtttgccgcctggtcctggtcgtgctgagcctgtggccagatacagctgtc
gcccctgggccaccacctggcccccctcgagtttccccagaccctcgggccgagctggac
agcaccgtgctcctgacccgctctctcctggcggacacgcggcagctggctgcacagctg
agggacaaattcccagctgacggggaccacaacctggattccctgcccaccctggccatg
agtgcgggggcactgggagctctacagctcccaggtgtgctgacaaggctgcgagcggac
ctactgtcctacctgcggcacgtgcagtggctgcgccgggcaggtggctcttccctgaag
accctggagcccgagctgggcaccctgcaggcccgactggaccggctgctgcgccggctg
cagctcctgatgtcccgcctggccctgccccagccacccccggacccgccggcgcccccg
ctggcgcccccctcctcagcctgggggggcatcagggccgcccacgccatcctggggggg
ctgcacctgacacttgactgggccgtgaggggactgctgctgctgaagactcggctgtga

KEGG   Homo sapiens (human): 3596
Entry
3596              CDS       T01001                                 
Symbol
IL13, IL-13, P600
Name
(RefSeq) interleukin 13
  KO
K05435  interleukin 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04664  Fc epsilon RI signaling pathway
hsa05200  Pathways in cancer
hsa05310  Asthma
hsa05321  Inflammatory bowel disease
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06518  JAK-STAT signaling
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N01556  IL6 family to Jak-STAT signaling pathway
Disease
H00079  Asthma
H00084  Graft-versus-host disease
H01358  Atopic dermatitis
H01360  Allergic rhinitis
Drug target
Anrukinzumab: D08857
Lebrikizumab: D09633
Romilkimab: D11598
Tralokinumab: D09979<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3596 (IL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3596 (IL13)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    3596 (IL13)
   04657 IL-17 signaling pathway
    3596 (IL13)
   04664 Fc epsilon RI signaling pathway
    3596 (IL13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3596 (IL13)
  09163 Immune disease
   05310 Asthma
    3596 (IL13)
   05321 Inflammatory bowel disease
    3596 (IL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3596 (IL13)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3596 (IL13)
SSDB
Motif
Pfam: IL13
Other DBs
NCBI-GeneID: 3596
NCBI-ProteinID: NP_002179
OMIM: 147683
HGNC: 5973
Ensembl: ENSG00000169194
Pharos: P35225(Tbio)
UniProt: P35225
Structure
LinkDB
Position
5:132656522..132661110
AA seq 146 aa
MHPLLNPLLLALGLMALLLTTVIALTCLGGFASPGPVPPSTALRELIEELVNITQNQKAP
LCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRD
TKIEVAQFVKDLLLHLKKLFREGQFN
NT seq 441 nt   +upstreamnt  +downstreamnt
atgcatccgctcctcaatcctctcctgttggcactgggcctcatggcgcttttgttgacc
acggtcattgctctcacttgccttggcggctttgcctccccaggccctgtgcctccctct
acagccctcagggagctcattgaggagctggtcaacatcacccagaaccagaaggctccg
ctctgcaatggcagcatggtatggagcatcaacctgacagctggcatgtactgtgcagcc
ctggaatccctgatcaacgtgtcaggctgcagtgccatcgagaagacccagaggatgctg
agcggattctgcccgcacaaggtctcagctgggcagttttccagcttgcatgtccgagac
accaaaatcgaggtggcccagtttgtaaaggacctgctcttacatttaaagaaacttttt
cgcgagggacagttcaactga

KEGG   Homo sapiens (human): 386653
Entry
386653            CDS       T01001                                 
Symbol
IL31, IL-31
Name
(RefSeq) interleukin 31
  KO
K22631  interleukin 31
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
Network
nt06518  JAK-STAT signaling
  Element
N01556  IL6 family to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    386653 (IL31)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    386653 (IL31)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    386653 (IL31)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   386653 (IL31)
SSDB
Motif
Pfam: IL31
Other DBs
NCBI-GeneID: 386653
NCBI-ProteinID: NP_001014358
OMIM: 609509
HGNC: 19372
Ensembl: ENSG00000204671
Pharos: Q6EBC2(Tbio)
UniProt: Q6EBC2
LinkDB
Position
12:complement(122172029..122174221)
AA seq 164 aa
MASHSGPSTSVLFLFCCLGGWLASHTLPVRLLRPSDDVQKIVEELQSLSKMLLKDVEEEK
GVLVSQNYTLPCLSPDAQPPNNIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAP
ETNISVPTDTHECKRFILTISQQFSECMDLALKSLTSGAQQATT
NT seq 495 nt   +upstreamnt  +downstreamnt
atggcctctcactcaggcccctcgacgtctgtgctctttctgttctgctgcctgggaggc
tggctggcctcccacacgttgcccgtccgtttactacgaccaagtgatgatgtacagaaa
atagtcgaggaattacagtccctctcgaagatgcttttgaaagatgtggaggaagagaag
ggcgtgctcgtgtcccagaattacacgctgccgtgtctcagccctgacgcccagccgcca
aacaacatccacagcccagccatccgggcatatctcaagacaatcagacagctagacaac
aaatctgttattgatgagatcatagagcacctcgacaaactcatatttcaagatgcacca
gaaacaaacatttctgtgccaacagacacccatgaatgtaaacgcttcatcctgactatt
tctcaacagttttcagagtgcatggacctcgcactaaaatcattgacctctggagcccaa
caggccaccacttaa

KEGG   Homo sapiens (human): 3976
Entry
3976              CDS       T01001                                 
Symbol
LIF, CDF, DIA, HILDA, MLPLI
Name
(RefSeq) LIF interleukin 6 family cytokine
  KO
K05419  leukemia inhibitory factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04630  JAK-STAT signaling pathway
hsa04668  TNF signaling pathway
Network
nt06518  JAK-STAT signaling
  Element
N01556  IL6 family to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3976 (LIF)
   04668 TNF signaling pathway
    3976 (LIF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3976 (LIF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3976 (LIF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3976 (LIF)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   3976 (LIF)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 3976
NCBI-ProteinID: NP_002300
OMIM: 159540
HGNC: 6596
Ensembl: ENSG00000128342
Pharos: P15018(Tbio)
UniProt: P15018
Structure
LinkDB
Position
22:complement(30240453..30246759)
AA seq 202 aa
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNIT
RDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKQIIAVLAQAF
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaggtcttggcggcaggagttgtgcccctgctgttggttctgcactggaaacatggg
gcggggagccccctccccatcacccctgtcaacgccacctgtgccatacgccacccatgt
cacaacaacctcatgaaccagatcaggagccaactggcacagctcaatggcagtgccaat
gccctctttattctctattacacagcccagggggagccgttccccaacaacctggacaag
ctatgtggccccaacgtgacggacttcccgcccttccacgccaacggcacggagaaggcc
aagctggtggagctgtaccgcatagtcgtgtaccttggcacctccctgggcaacatcacc
cgggaccagaagatcctcaaccccagtgccctcagcctccacagcaagctcaacgccacc
gccgacatcctgcgaggcctccttagcaacgtgctgtgccgcctgtgcagcaagtaccac
gtgggccatgtggacgtgacctacggccctgacacctcgggtaaggatgtcttccagaag
aagaagctgggctgtcaactcctggggaagtataagcagatcatcgccgtgttggcccag
gccttctag

KEGG   Homo sapiens (human): 5008
Entry
5008              CDS       T01001                                 
Symbol
OSM
Name
(RefSeq) oncostatin M
  KO
K05418  oncostatin M
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
Network
nt06518  JAK-STAT signaling
  Element
N01556  IL6 family to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    5008 (OSM)
   04151 PI3K-Akt signaling pathway
    5008 (OSM)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    5008 (OSM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    5008 (OSM)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   5008 (OSM)
SSDB
Motif
Pfam: LIF_OSM
Other DBs
NCBI-GeneID: 5008
NCBI-ProteinID: NP_065391
OMIM: 165095
HGNC: 8506
Ensembl: ENSG00000099985
Pharos: P13725(Tbio)
UniProt: P13725
Structure
LinkDB
Position
22:complement(30262829..30266851)
AA seq 252 aa
MGVLLTQRTLLSLVLALLFPSMASMAAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYI
RIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKA
QDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTP
ASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRRTRPSRK
GKRLMTRGQLPR
NT seq 759 nt   +upstreamnt  +downstreamnt
atgggggtactgctcacacagaggacgctgctcagtctggtccttgcactcctgtttcca
agcatggcgagcatggcggctataggcagctgctcgaaagagtaccgcgtgctccttggc
cagctccagaagcagacagatctcatgcaggacaccagcagactcctggacccctatata
cgtatccaaggcctggatgttcctaaactgagagagcactgcagggagcgccccggggcc
ttccccagtgaggagaccctgagggggctgggcaggcggggcttcctgcagaccctcaat
gccacactgggctgcgtcctgcacagactggccgacttagagcagcgcctccccaaggcc
caggatttggagaggtctgggctgaacatcgaggacttggagaagctgcagatggcgagg
ccgaacatcctcgggctcaggaacaacatctactgcatggcccagctgctggacaactca
gacacggctgagcccacgaaggctggccggggggcctctcagccgcccacccccacccct
gcctcggatgcttttcagcgcaagctggagggctgcaggttcctgcatggctaccatcgc
ttcatgcactcagtggggcgggtcttcagcaagtggggggagagcccgaaccggagccgg
agacacagcccccaccaggccctgaggaagggggtgcgcaggaccagaccctccaggaaa
ggcaagagactcatgaccaggggacagctgccccggtag

DBGET integrated database retrieval system