Homo sapiens (human): 127124 Help Entry 127124            CDS       T01001                                  Symbol ATP6V1G3, ATP6G3, Vma10 Name (RefSeq) ATPase H+ transporting V1 subunit G3   KO K02152   V-type H+-transporting ATPase subunit G Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04145   Phagosome hsa04150   mTOR signaling pathway hsa04721   Synaptic vesicle cycle hsa04966   Collecting duct acid secretion hsa05110   Vibrio cholerae infection hsa05120   Epithelial cell signaling in Helicobacter pylori infection hsa05165   Human papillomavirus infection hsa05323   Rheumatoid arthritis Module hsa_M00160   V-type ATPase, eukaryotes Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     127124 (ATP6V1G3)  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     127124 (ATP6V1G3)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     127124 (ATP6V1G3)  09150 Organismal Systems   09155 Excretory system    04966 Collecting duct acid secretion     127124 (ATP6V1G3)   09156 Nervous system    04721 Synaptic vesicle cycle     127124 (ATP6V1G3)  09160 Human Diseases   09172 Infectious disease: viral    05165 Human papillomavirus infection     127124 (ATP6V1G3)   09171 Infectious disease: bacterial    05110 Vibrio cholerae infection     127124 (ATP6V1G3)    05120 Epithelial cell signaling in Helicobacter pylori infection     127124 (ATP6V1G3)   09163 Immune disease    05323 Rheumatoid arthritis     127124 (ATP6V1G3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  V-ATPase_G FdhE TorS_sensor_domain RNase_Y_N OmpH DUF2852 T3SS_basalb_I Motif Other DBs NCBI-GeneID:  127124 NCBI-ProteinID:  NP_573569 OMIM:  618071 HGNC:  18265 Ensembl:  ENSG00000151418 Pharos:  Q96LB4(Tbio) UniProt:  Q96LB4 LinkDB All DBs Position 1:complement(198523222..198540945) Genome browser AA seq 118 aa AA seqDB search MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQS KIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgacaagccagtctcaggggatccaccagcttcttcaggcagaaaaacgggccaaggac aagctagaggaagccaagaagagaaaaggaaagcgattgaagcaagccaaggaggaagca atggtagaaattgaccagtacagaatgcagagagataaagagtttcgactaaaacaatct aagataatgggctctcagaataatctctcagatgaaatagaagaacaaacactagggaag atacaagaacttaatggacactacaataagtatatggaaagtgtgatgaaccagctcttg agcatggtctgtgacatgaaaccagaaatccatgtgaactacagagccaccaactaa

Homo sapiens (human): 534 Help Entry 534               CDS       T01001                                  Symbol ATP6V1G2, ATP6G, ATP6G2, NG38, VMA10 Name (RefSeq) ATPase H+ transporting V1 subunit G2   KO K02152   V-type H+-transporting ATPase subunit G Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04145   Phagosome hsa04150   mTOR signaling pathway hsa04721   Synaptic vesicle cycle hsa04966   Collecting duct acid secretion hsa05110   Vibrio cholerae infection hsa05120   Epithelial cell signaling in Helicobacter pylori infection hsa05165   Human papillomavirus infection hsa05323   Rheumatoid arthritis Module hsa_M00160   V-type ATPase, eukaryotes Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     534 (ATP6V1G2)  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     534 (ATP6V1G2)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     534 (ATP6V1G2)  09150 Organismal Systems   09155 Excretory system    04966 Collecting duct acid secretion     534 (ATP6V1G2)   09156 Nervous system    04721 Synaptic vesicle cycle     534 (ATP6V1G2)  09160 Human Diseases   09172 Infectious disease: viral    05165 Human papillomavirus infection     534 (ATP6V1G2)   09171 Infectious disease: bacterial    05110 Vibrio cholerae infection     534 (ATP6V1G2)    05120 Epithelial cell signaling in Helicobacter pylori infection     534 (ATP6V1G2)   09163 Immune disease    05323 Rheumatoid arthritis     534 (ATP6V1G2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  V-ATPase_G Zein-binding Motif Other DBs NCBI-GeneID:  534 NCBI-ProteinID:  NP_569730 OMIM:  606853 HGNC:  862 Ensembl:  ENSG00000213760 Pharos:  O95670(Tdark) UniProt:  O95670 Q6NVJ2 LinkDB All DBs Position 6:complement(31544444..31546742) Genome browser AA seq 118 aa AA seqDB search MASQSQGIQQLLQAEKRAAEKVADARKRKARRLKQAKEEAQMEVEQYRREREHEFQSKQQ AAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggccagtcagtcccaaggtatccagcagcttctgcaagctgagaagcgggcagctgag aaggtggcagatgccagaaagaggaaggcccggcgactgaagcaggcaaaggaggaggca cagatggaggtggagcaataccgcagagagcgagagcacgaattccagagcaagcagcag gcggccatgggctcccaggggaacctgtctgctgaggtggagcaggctacaaggcgccag gtgcagggcatgcagagctcccagcagagaaaccgagagcgtgtcctggcccagcttctt ggcatggtctgcgacgtcaggccccaggtccaccccaactaccggatttctgcctag

Homo sapiens (human): 9550 Help Entry 9550              CDS       T01001                                  Symbol ATP6V1G1, ATP6G, ATP6G1, ATP6GL, ATP6J, Vma10 Name (RefSeq) ATPase H+ transporting V1 subunit G1   KO K02152   V-type H+-transporting ATPase subunit G Organism hsa  Homo sapiens (human) Pathway hsa00190   Oxidative phosphorylation hsa01100   Metabolic pathways hsa04145   Phagosome hsa04150   mTOR signaling pathway hsa04721   Synaptic vesicle cycle hsa04966   Collecting duct acid secretion hsa05110   Vibrio cholerae infection hsa05120   Epithelial cell signaling in Helicobacter pylori infection hsa05165   Human papillomavirus infection hsa05323   Rheumatoid arthritis Module hsa_M00160   V-type ATPase, eukaryotes Brite KEGG Orthology (KO) [BR:hsa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     9550 (ATP6V1G1)  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     9550 (ATP6V1G1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     9550 (ATP6V1G1)  09150 Organismal Systems   09155 Excretory system    04966 Collecting duct acid secretion     9550 (ATP6V1G1)   09156 Nervous system    04721 Synaptic vesicle cycle     9550 (ATP6V1G1)  09160 Human Diseases   09172 Infectious disease: viral    05165 Human papillomavirus infection     9550 (ATP6V1G1)   09171 Infectious disease: bacterial    05110 Vibrio cholerae infection     9550 (ATP6V1G1)    05120 Epithelial cell signaling in Helicobacter pylori infection     9550 (ATP6V1G1)   09163 Immune disease    05323 Rheumatoid arthritis     9550 (ATP6V1G1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  V-ATPase_G FdhE CSRNP_N DUF2362 MPM1 DUF4778 OmpH Motif Other DBs NCBI-GeneID:  9550 NCBI-ProteinID:  NP_004879 OMIM:  607296 HGNC:  864 Ensembl:  ENSG00000136888 Pharos:  O75348(Tbio) UniProt:  O75348 Structure PDBPDBj LinkDB All DBs Position 9:114587769..114598879 Genome browser AA seq 118 aa AA seqDB search MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKAKEA AALGSRGSCSTEVEKETQEKMTILQTYFRQNRDEVLDNLLAFVCDIRPEIHENYRING NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggctagtcagtctcaggggattcagcagctgctgcaggccgagaagcgggcagccgag aaggtgtccgaggcccgcaaaagaaagaaccggaggctgaagcaggccaaagaagaagct caggctgaaattgaacagtaccgcctgcagagggagaaagaattcaaggccaaggaagct gcggcattgggatcccgtggcagttgcagcactgaagtggagaaggagacccaggagaag atgaccatcctccagacatacttccggcagaacagggatgaagtcttggacaacctcttg gcttttgtctgtgacattcggccagaaatccatgaaaactaccgcataaatggatag

DBGET integrated database retrieval system