KEGG   Homo sapiens (human): 128866
Entry
128866            CDS       T01001                                 
Symbol
CHMP4B, C20orf178, CHMP4A, CTPP3, CTRCT31, SNF7, SNF7-2, Shax1, VPS32B, Vps32-2, dJ553F4.4
Name
(RefSeq) charged multivesicular body protein 4B
  KO
K12194  charged multivesicular body protein 4A/B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03250  Viral life cycle - HIV-1
hsa04144  Endocytosis
hsa04217  Necroptosis
Disease
H01202  Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    128866 (CHMP4B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    128866 (CHMP4B)
  09143 Cell growth and death
   04217 Necroptosis
    128866 (CHMP4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    128866 (CHMP4B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    128866 (CHMP4B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    128866 (CHMP4B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   128866 (CHMP4B)
  Exosomal proteins of other body fluids (saliva and urine)
   128866 (CHMP4B)
  Exosomal proteins of colorectal cancer cells
   128866 (CHMP4B)
SSDB
Motif
Pfam: Snf7 SYF2
Other DBs
NCBI-GeneID: 128866
NCBI-ProteinID: NP_789782
OMIM: 610897
HGNC: 16171
Ensembl: ENSG00000101421
Pharos: Q9H444(Tbio)
UniProt: Q9H444
Structure
LinkDB
Position
20:33811348..33854366
AA seq 224 aa
MSVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTK
NKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH
DNMDIDKVDELMQDIADQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNL
LEISGPETVPLPNVPSIALPSKPAKKKEEEDDDMKELENWAGSM
NT seq 675 nt   +upstreamnt  +downstreamnt
atgtcggtgttcgggaagctgttcggggctggagggggtaaggccggcaagggcggcccg
accccccaggaggccatccagcggctgcgggacacggaagagatgttaagcaagaaacag
gagttcctggagaagaaaatcgagcaggagctgacggccgccaagaagcacggcaccaaa
aacaagcgcgcggccctccaggcactgaagcgtaagaagaggtatgagaagcagctggcg
cagatcgacggcacattatcaaccatcgagttccagcgggaggccctggagaatgccaac
accaacaccgaggtgctcaagaacatgggctatgccgccaaggccatgaaggcggcccat
gacaacatggacatcgataaagttgatgagttaatgcaggacattgctgaccagcaagaa
cttgcagaggagatttcaacagcaatttcgaaacctgtagggtttggagaagagtttgac
gaggatgagctcatggcggaattagaagaactagaacaggaggaactagacaagaatttg
ctggaaatcagtggacccgaaacagtccctctaccaaatgttccctctatagccctacca
tcaaaacccgccaagaagaaagaagaggaggacgacgacatgaaggaattggagaactgg
gctggatccatgtaa

KEGG   Homo sapiens (human): 29082
Entry
29082             CDS       T01001                                 
Symbol
CHMP4A, C14orf123, CHMP4, CHMP4B, HSPC134, SHAX2, SNF7, SNF7-1, VPS32-1, VPS32A
Name
(RefSeq) charged multivesicular body protein 4A
  KO
K12194  charged multivesicular body protein 4A/B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03250  Viral life cycle - HIV-1
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    29082 (CHMP4A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    29082 (CHMP4A)
  09143 Cell growth and death
   04217 Necroptosis
    29082 (CHMP4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    29082 (CHMP4A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    29082 (CHMP4A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    29082 (CHMP4A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29082 (CHMP4A)
  Exosomal proteins of other body fluids (saliva and urine)
   29082 (CHMP4A)
  Exosomal proteins of colorectal cancer cells
   29082 (CHMP4A)
SSDB
Motif
Pfam: Snf7 SYF2 CATRA-C Ribonuc_2-5A
Other DBs
NCBI-GeneID: 29082
NCBI-ProteinID: NP_054888
OMIM: 610051
HGNC: 20274
Ensembl: ENSG00000254505
Pharos: Q9BY43(Tbio)
UniProt: Q9BY43
Structure
LinkDB
Position
14:complement(24209615..24213488)
AA seq 222 aa
MSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKR
AALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDM
DIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNV
GDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS
NT seq 669 nt   +upstreamnt  +downstreamnt
atgagtggtctcggcaggctcttcgggaaggggaagaaggagaaagggccaacccctgaa
gaagcaatacagaaactgaaggagacagagaagatactgatcaagaaacaggaatttttg
gagcagaagattcaacaggagctacaaacagccaagaagtatgggaccaagaataagaga
gctgccctacaggctttgcggaggaagaaaagattcgaacagcagctggcacaaactgac
gggacattatccaccctggagtttcagcgtgaggccattgagaatgccactaccaatgca
gaagtccttcgtaccatggagcttgctgcccaaagcatgaagaaggcctaccaggacatg
gacattgacaaggtagatgaactgatgactgacatcacggaacaacaggaggtggcccag
cagatctcagatgccatttctcggcctatgggctttggagatgatgtggatgaggatgaa
ctgctggaggagctagaggagctggagcaggaggaattggcccaggagttgttaaatgtg
ggcgacaaggaagaagaaccctcagtcaaattgcctagtgtaccttctactcatctgccg
gcagggccagctcccaaagtggatgaagatgaagaagcactaaagcagttggctgagtgg
gtatcctga

KEGG   Homo sapiens (human): 92421
Entry
92421             CDS       T01001                                 
Symbol
CHMP4C, SNF7-3, Shax3, VPS32C
Name
(RefSeq) charged multivesicular body protein 4C
  KO
K24782  charged multivesicular body protein 4C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    92421 (CHMP4C)
  09143 Cell growth and death
   04217 Necroptosis
    92421 (CHMP4C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    92421 (CHMP4C)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    92421 (CHMP4C)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    92421 (CHMP4C)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    92421 (CHMP4C)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    92421 (CHMP4C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   92421 (CHMP4C)
  Exosomal proteins of colorectal cancer cells
   92421 (CHMP4C)
SSDB
Motif
Pfam: Snf7 DUF155
Other DBs
NCBI-GeneID: 92421
NCBI-ProteinID: NP_689497
OMIM: 610899
HGNC: 30599
Ensembl: ENSG00000164695
Pharos: Q96CF2(Tbio)
UniProt: Q96CF2
Structure
LinkDB
Position
8:81732448..81759515
AA seq 233 aa
MSKLGKFFKGGGSSKSRAAPSPQEALVRLRETEEMLGKKQEYLENRIQREIALAKKHGTQ
NKRAALQALKRKKRFEKQLTQIDGTLSTIEFQREALENSHTNTEVLRNMGFAAKAMKSVH
ENMDLNKIDDLMQEITEQQDIAQEISEAFSQRVGFGDDFDEDELMAELEELEQEELNKKM
TNIRLPNVPSSSLPAQPNRKPGMSSTARRSRAASSQRAEEEDDDIKQLAAWAT
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagcaagttgggcaagttctttaaagggggcggctcttctaagagccgagccgctccc
agtccccaggaggccctggtccgacttcgggagactgaggagatgctgggcaagaaacaa
gagtacctggaaaatcgaatccagagagaaatcgccctggccaagaagcacggcacgcag
aataagcgagctgcattacaggcactaaagagaaagaagaggttcgagaaacagctcact
cagattgatggcacactttctaccattgagttccagagagaagccctggagaactcacac
accaacactgaggtgttgaggaacatgggctttgcagcaaaagcgatgaaatctgttcat
gaaaacatggatctgaacaaaatagatgatttgatgcaagagatcacagagcaacaggat
atcgcccaagaaatctcagaagcattttctcaacgggttggctttggtgatgactttgat
gaggatgagttgatggcagaacttgaagaattggaacaggaggaattaaataagaagatg
acaaatatccgccttccaaatgtgccttcctcttctctcccagcacagccaaatagaaaa
ccaggcatgtcgtccactgcacgtcgatcccgagcagcatcttcccagagggcagaagaa
gaggatgatgatatcaaacaattggcagcttgggctacctaa

DBGET integrated database retrieval system