KEGG   Homo sapiens (human): 130367
Entry
130367            CDS       T01001                                 
Symbol
SGPP2, SPP2, SPPase2
Name
(RefSeq) sphingosine-1-phosphate phosphatase 2
  KO
K04717  sphingosine-1-phosphate phosphotase 2 [EC:3.1.3.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    130367 (SGPP2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    130367 (SGPP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-
     130367 (SGPP2)
SSDB
Motif
Pfam: PAP2 PAP2_3 DUF212
Other DBs
NCBI-GeneID: 130367
NCBI-ProteinID: NP_689599
OMIM: 612827
HGNC: 19953
Ensembl: ENSG00000163082
Pharos: Q8IWX5(Tbio)
UniProt: Q8IWX5
LinkDB
Position
2:222423988..222562621
AA seq 399 aa
MAELLRSLQDSQLVARFQRRCGLFPAPDEGPRENGADPTERAARVPGVEHLPAANGKGGE
APANGLRRAAAPEAYVQKYVVKNYFYYYLFQFSAALGQEVFYITFLPFTHWNIDPYLSRR
LIIIWVLVMYIGQVAKDVLKWPRPSSPPVVKLEKRLIAEYGMPSTHAMAATAIAFTLLIS
TMDRYQYPFVLGLVMAVVFSTLVCLSRLYTGMHTVLDVLGGVLITALLIVLTYPAWTFID
CLDSASPLFPVCVIVVPFFLCYNYPVSDYYSPTRADTTTILAAGAGVTIGFWINHFFQLV
SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVLYSWFKVVTRN
KEARRRLEIEVPYKFVTYTSVGICATTFVPMLHRFLGLP
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggccgagctgctgcggagcctgcaggattcccagctcgtcgcccgcttccagcgccgc
tgcgggctcttccccgctccggatgaaggcccccgggagaacggcgcggaccccacggag
cgcgcggcgcgggtccccggggtcgagcatctccccgcagccaacggcaagggcggcgag
gctccggccaacgggctgcgcagagccgcggcgccggaggcttatgtacagaagtacgtc
gtgaagaattatttctactattacctattccaattttcagctgctttgggccaagaagtg
ttctacatcacgtttcttccattcactcactggaatattgacccttatttatccagaaga
ttgatcatcatatgggttttggtgatgtatattggccaagtggccaaggatgtcttgaag
tggccccgtccctcctcccctccagttgtaaaactggaaaagagactgatcgctgaatat
ggaatgccatccacccacgccatggcggccactgccattgccttcaccctccttatctct
actatggacagataccagtatccatttgtgttgggactggtgatggccgtggtgttttcc
accttggtgtgtctcagcaggctctacactgggatgcatacggtcctggatgtgctgggt
ggcgtcctgatcaccgcactcctcatcgtcctcacctaccctgcctggaccttcatcgac
tgcctggactcggccagccccctcttccccgtgtgtgtcatagttgtgccattcttcctg
tgttacaattaccctgtttctgattactacagcccaacccgggcggacaccaccaccatt
ctggctgccggggctggagtgaccataggattctggatcaaccatttcttccagcttgta
tccaagcccgctgaatctctccctgttattcagaacatcccaccactcaccacctacatg
ttagttttgggtctgaccaaatttgcagtgggaattgtgttgatcctcttggttcgtcag
cttgtacaaaatctctcactgcaagtattatactcatggttcaaggtggtcaccaggaac
aaggaggccaggcggagactggagattgaagtgccttacaagtttgttacctacacatct
gttggcatctgcgctacaacctttgtgccgatgcttcacaggtttctgggattaccctga

KEGG   Homo sapiens (human): 81537
Entry
81537             CDS       T01001                                 
Symbol
SGPP1, SPP-1, SPPase1
Name
(RefSeq) sphingosine-1-phosphate phosphatase 1
  KO
K04716  sphingosine-1-phosphate phosphatase 1 [EC:3.1.3.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    81537 (SGPP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    81537 (SGPP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-
     81537 (SGPP1)
SSDB
Motif
Pfam: PAP2 PAP2_3
Other DBs
NCBI-GeneID: 81537
NCBI-ProteinID: NP_110418
OMIM: 612826
HGNC: 17720
Ensembl: ENSG00000126821
Pharos: Q9BX95(Tbio)
UniProt: Q9BX95
LinkDB
Position
14:complement(63684216..63728065)
AA seq 441 aa
MSLRQRLAQLVGRLQDPQKVARFQRLCGVEAPPRRSADRREDEKAEAPLAGDPRLRGRQP
GAPGGPQPPGSDRNQCPAKPDGGGAPNGVRNGLAAELGPASPRRAGALRRNSLTGEEGQL
ARVSNWPLYCLFCFGTELGNELFYILFFPFWIWNLDPLVGRRLVVIWVLVMYLGQCTKDI
IRWPRPASPPVVKLEVFYNSEYSMPSTHAMSGTAIPISMVLLTYGRWQYPLIYGLILIPC
WCSLVCLSRIYMGMHSILDIIAGFLYTILILAVFYPFVDLIDNFNQTHKYAPFIIIGLHL
ALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVTYNMGLVLDPSLDTLPLAGPPITVT
LFGKAILRILIGMVFVLIIRDVMKKITIPLACKIFNIPCDDIRKARQHMEVELPYRYITY
GMVGFSITFFVPYIFFFIGIS
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgtcgctgaggcagcgcctggcccagctggttggccgtctgcaggacccgcagaaagtg
gcccgtttccagcggctgtgcggggtggaagcgccgccgcgccgctcagcagaccggagg
gaggatgagaaagcggaggcgcctctcgccggagaccctcgactgcgagggcggcagcca
ggggcgcctggaggcccccagcctcccgggagcgaccgcaatcagtgcccggccaagccg
gacggcggcggcgcccccaacggcgtgcggaacgggctggcggccgagctgggcccggcc
tcgccgcggcgcgcgggcgctctgcgccgcaactcgctgacgggcgaggagggccagctg
gcccgcgtgagcaactggccgctctactgcctgttctgcttcggcacggagctgggcaac
gaactcttctacatcctgttcttccccttctggatctggaacctggaccctctggtgggc
cggaggctcgtggtcatctgggtgctggtcatgtacctgggccagtgcaccaaggacatc
atccgctggccgaggcccgcctcgccgcccgtggtcaagttggaggtcttctacaactct
gagtacagcatgccctccacccatgccatgtccggcaccgccatccccatttctatggtc
ctcctcacctatggccgctggcagtaccctcttatatatggactgattcttattccctgc
tggtgttctctagtttgcctaagtagaatttacatgggaatgcactctattctggatatt
attgctggattcctatataccattttaatcttagctgtcttctatccatttgtggacctg
attgacaacttcaaccaaactcacaaatatgctccattcatcatcatcgggcttcattta
gctttggggatcttttctttcactcttgacacctggagcacatcccgaggagacacagcc
gagatactaggaagtggtgctggaattgcatgtggatctcatgttacttataacatgggt
ctagtattagatccttctctagatacattacctttagctgggccccccattactgtgact
ctgtttggaaaagccatattgcggatcctcatagggatggtatttgtactaataatcaga
gatgtaatgaaaaagatcaccattcctttagcctgcaaaatcttcaatataccgtgtgat
gatattcgaaaagcaagacagcacatggaagttgaacttccttatcggtatattacctat
ggaatggttggtttctccatcacattttttgttccttacatatttttctttattggtatc
tcttga

DBGET integrated database retrieval system