KEGG   Homo sapiens (human): 130399
Entry
130399            CDS       T01001                                 
Symbol
ACVR1C, ACVRLK7, ALK7
Name
(RefSeq) activin A receptor type 1C
  KO
K13568  activin receptor type-1C [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    130399 (ACVR1C)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    130399 (ACVR1C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    130399 (ACVR1C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    130399 (ACVR1C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     130399 (ACVR1C)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   130399 (ACVR1C)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TGF_beta_GS Activin_recp Pkinase_fungal
Other DBs
NCBI-GeneID: 130399
NCBI-ProteinID: NP_660302
OMIM: 608981
HGNC: 18123
Ensembl: ENSG00000123612
Vega: OTTHUMG00000131964
Pharos: Q8NER5(Tbio)
UniProt: Q8NER5
LinkDB
Position
2:complement(157526767..157628864)
AA seq 493 aa
MTRALCSALRQALLLLAAAAELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVI
KSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHLPTASPNAPKLGPMELAIIITV
PVCLLSIAAMLTVWACQGRQCSYRKKKRPNVEEPLSECNLVNAGKTLKDLIYDVTASGSG
SGLPLLVQRTIARTIVLQEIVGKGRFGEVWHGRWCGEDVAVKIFSSRDERSWFREAEIYQ
TVMLRHENILGFIAADNKDNGTWTQLWLVSEYHEQGSLYDYLNRNIVTVAGMIKLALSIA
SGLAHLHMEIVGTQGKPAIAHRDIKSKNILVKKCETCAIADLGLAVKHDSILNTIDIPQN
PKVGTKRYMAPEMLDDTMNVNIFESFKRADIYSVGLVYWEIARRCSVGGIVEEYQLPYYD
MVPSDPSIEEMRKVVCDQKFRPSIPNQWQSCEALRVMGRIMRECWYANGAARLTALRIKK
TISQLCVKEDCKA
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgacccgggcgctctgctcagcgctccgccaggctctcctgctgctcgcagcggccgcc
gagctctcgccaggactgaagtgtgtatgtcttttgtgtgattcttcaaacttcacctgc
caaacagaaggagcatgttgggcatcagtcatgctaaccaatggaaaagagcaggtgatc
aaatcctgtgtctcccttccagaactgaatgctcaagtcttctgtcatagttccaacaat
gttaccaaaaccgaatgctgcttcacagatttttgcaacaacataacactgcaccttcca
acagcatcaccaaatgccccaaaacttggacccatggagctggccatcattattactgtg
cctgtttgcctcctgtccatagctgcgatgctgacagtatgggcatgccagggtcgacag
tgctcctacaggaagaaaaagagaccaaatgtggaggaaccactctctgagtgcaatctg
gtaaatgctggaaaaactctgaaagatctgatttatgatgtgaccgcctctggatctggc
tctggtctacctctgttggttcaaaggacaattgcaaggacgattgtgcttcaggaaata
gtaggaaaaggtagatttggtgaggtgtggcatggaagatggtgtggggaagatgtggct
gtgaaaatattctcctccagagatgaaagatcttggtttcgtgaggcagaaatttaccag
acggtcatgctgcgacatgaaaacatccttggtttcattgctgctgacaacaaagataat
ggaacttggactcaactttggctggtatctgaatatcatgaacagggctccttatatgac
tatttgaatagaaatatagtgaccgtggctggaatgatcaagctggcgctctcaattgct
agtggtctggcacaccttcatatggagattgttggtacacaaggtaaacctgctattgct
catcgagacataaaatcaaagaatatcttagtgaaaaagtgtgaaacttgtgccatagcg
gacttagggttggctgtgaagcatgattcaatactgaacactatcgacatacctcagaat
cctaaagtgggaaccaagaggtatatggctcctgaaatgcttgatgatacaatgaatgtg
aatatctttgagtccttcaaacgagctgacatctattctgttggtctggtttactgggaa
atagcccggaggtgttcagtcggaggaattgttgaggagtaccaattgccttattatgac
atggtgccttcagatccctcgatagaggaaatgagaaaggttgtttgtgaccagaagttt
cgaccaagtatcccaaaccagtggcaaagttgtgaagcactccgagtcatggggagaata
atgcgtgagtgttggtatgccaacggagcggcccgcctaactgctcttcgtattaagaag
actatatctcaactttgtgtcaaagaagactgcaaagcctaa

KEGG   Homo sapiens (human): 91
Entry
91                CDS       T01001                                 
Symbol
ACVR1B, ACTRIB, ACVRLK4, ALK4, SKR2
Name
(RefSeq) activin A receptor type 1B
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    91 (ACVR1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    91 (ACVR1B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    91 (ACVR1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    91 (ACVR1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     91 (ACVR1B)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   91 (ACVR1B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp APH Pkinase_fungal FTA2
Other DBs
NCBI-GeneID: 91
NCBI-ProteinID: NP_004293
OMIM: 601300
HGNC: 172
Ensembl: ENSG00000135503
Vega: OTTHUMG00000167920
Pharos: P36896(Tchem)
UniProt: P36896
LinkDB
Position
12:51951699..51997078
AA seq 505 aa
MAESAGASSFFPLVVLLLAGSGGSGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLD
GMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPS
MWGPVELVGIIAGPVFLLFLIIIIVFLVINYHQRVYHNRQRLDMEDPSCEMCLSKDKTLQ
DLVYDLSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVAVKIFSSRE
ERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVT
IEGMIKLALSAASGLAHLHMEIVGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRH
DAVTDTIDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNSG
GVHEEYQLPYYDLVPSDPSIEEMRKVVCDQKLRPNIPNWWQSYEALRVMGKMMRECWYAN
GAARLTALRIKKTLSQLSVQEDVKI
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggcggagtcggccggagcctcctccttcttcccccttgttgtcctcctgctcgccggc
agcggcgggtccgggccccggggggtccaggctctgctgtgtgcgtgcaccagctgcctc
caggccaactacacgtgtgagacagatggggcctgcatggtttccattttcaatctggat
gggatggagcaccatgtgcgcacctgcatccccaaagtggagctggtccctgccgggaag
cccttctactgcctgagctcggaggacctgcgcaacacccactgctgctacactgactac
tgcaacaggatcgacttgagggtgcccagtggtcacctcaaggagcctgagcacccgtcc
atgtggggcccggtggagctggtaggcatcatcgccggcccggtgttcctcctgttcctc
atcatcatcattgttttccttgtcattaactatcatcagcgtgtctatcacaaccgccag
agactggacatggaagatccctcatgtgagatgtgtctctccaaagacaagacgctccag
gatcttgtctacgatctctccacctcagggtctggctcagggttacccctctttgtccag
cgcacagtggcccgaaccatcgttttacaagagattattggcaagggtcggtttggggaa
gtatggcggggccgctggaggggtggtgatgtggctgtgaaaatattctcttctcgtgaa
gaacggtcttggttcagggaagcagagatataccagacggtcatgctgcgccatgaaaac
atccttggatttattgctgctgacaataaagataatggcacctggacacagctgtggctt
gtttctgactatcatgagcacgggtccctgtttgattatctgaaccggtacacagtgaca
attgaggggatgattaagctggccttgtctgctgctagtgggctggcacacctgcacatg
gagatcgtgggcacccaagggaagcctggaattgctcatcgagacttaaagtcaaagaac
attctggtgaagaaaaatggcatgtgtgccatagcagacctgggcctggctgtccgtcat
gatgcagtcactgacaccattgacattgccccgaatcagagggtggggaccaaacgatac
atggcccctgaagtacttgatgaaaccattaatatgaaacactttgactcctttaaatgt
gctgatatttatgccctcgggcttgtatattgggagattgctcgaagatgcaattctgga
ggagtccatgaagaatatcagctgccatattacgacttagtgccctctgacccttccatt
gaggaaatgcgaaaggttgtatgtgatcagaagctgcgtcccaacatccccaactggtgg
cagagttatgaggcactgcgggtgatggggaagatgatgcgagagtgttggtatgccaac
ggcgcagcccgcctgacggccctgcgcatcaagaagaccctctcccagctcagcgtgcag
gaagacgtgaagatctaa

KEGG   Homo sapiens (human): 92
Entry
92                CDS       T01001                                 
Symbol
ACVR2A, ACTRII, ACVR2
Name
(RefSeq) activin A receptor type 2A
  KO
K04670  activin receptor type-2A [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05418  Fluid shear stress and atherosclerosis
Drug target
Bimagrumab: D10620
Sotatercept: D09670
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    92 (ACVR2A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    92 (ACVR2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    92 (ACVR2A)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    92 (ACVR2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    92 (ACVR2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     92 (ACVR2A)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   92 (ACVR2A)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp Pkinase_fungal APH QVR
Other DBs
NCBI-GeneID: 92
NCBI-ProteinID: NP_001265508
OMIM: 102581
HGNC: 173
Ensembl: ENSG00000121989
Vega: OTTHUMG00000150603
Pharos: P27037(Tbio)
UniProt: P27037
Structure
LinkDB
Position
2:147844517..147930822
AA seq 513 aa
MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHC
FATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEM
EVTQPTSNPVTPKPPYYNILLYSLVPLMLIAGIVICAFWVYRHHKMAYPPVLVPTQDPGP
PPPSPLLGLKPLQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPG
MKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGL
AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDTHGQV
GTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELASRCTAADGPVDEYMLPFEEEIG
QHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERIT
QMQRLTNIITTEDIVTVVTMVTNVDFPPKESSL
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgggagctgctgcaaagttggcgtttgccgtctttcttatctcctgttcttcaggtgct
atacttggtagatcagaaactcaggagtgtcttttctttaatgctaattgggaaaaagac
agaaccaatcaaactggtgttgaaccgtgttatggtgacaaagataaacggcggcattgt
tttgctacctggaagaatatttctggttccattgaaatagtgaaacaaggttgttggctg
gatgatatcaactgctatgacaggactgattgtgtagaaaaaaaagacagccctgaagta
tatttttgttgctgtgagggcaatatgtgtaatgaaaagttttcttattttccggagatg
gaagtcacacagcccacttcaaatccagttacacctaagccaccctattacaacatcctg
ctctattccttggtgccacttatgttaattgcggggattgtcatttgtgcattttgggtg
tacaggcatcacaagatggcctaccctcctgtacttgttccaactcaagacccaggacca
cccccaccttctccattactaggtttgaaaccactgcagttattagaagtgaaagcaagg
ggaagatttggttgtgtctggaaagcccagttgcttaacgaatatgtggctgtcaaaata
tttccaatacaggacaaacagtcatggcaaaatgaatacgaagtctacagtttgcctgga
atgaagcatgagaacatattacagttcattggtgcagaaaaacgaggcaccagtgttgat
gtggatctttggctgatcacagcatttcatgaaaagggttcactatcagactttcttaag
gctaatgtggtctcttggaatgaactgtgtcatattgcagaaaccatggctagaggattg
gcatatttacatgaggatatacctggcctaaaagatggccacaaacctgccatatctcac
agggacatcaaaagtaaaaatgtgctgttgaaaaacaacctgacagcttgcattgctgac
tttgggttggccttaaaatttgaggctggcaagtctgcaggcgatacccatggacaggtt
ggtacccggaggtacatggctccagaggtattagagggtgctataaacttccaaagggat
gcatttttgaggatagatatgtatgccatgggattagtcctatgggaactggcttctcgc
tgtactgctgcagatggacctgtagatgaatacatgttgccatttgaggaggaaattggc
cagcatccatctcttgaagacatgcaggaagttgttgtgcataaaaaaaagaggcctgtt
ttaagagattattggcagaaacatgctggaatggcaatgctctgtgaaaccattgaagaa
tgttgggatcacgacgcagaagccaggttatcagctggatgtgtaggtgaaagaattacc
cagatgcagagactaacaaatattattaccacagaggacattgtaacagtggtcacaatg
gtgacaaatgttgactttcctcccaaagaatctagtctatga

KEGG   Homo sapiens (human): 93
Entry
93                CDS       T01001                                 
Symbol
ACVR2B, ACTRIIB, ActR-IIB, HTX4
Name
(RefSeq) activin A receptor type 2B
  KO
K13596  activin receptor type-2B [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05418  Fluid shear stress and atherosclerosis
Disease
H00632  Heterotaxy
Drug target
Bimagrumab: D10620
Luspatercept: D11701<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    93 (ACVR2B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    93 (ACVR2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    93 (ACVR2B)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    93 (ACVR2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    93 (ACVR2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     93 (ACVR2B)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   93 (ACVR2B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp Pkinase_fungal
Other DBs
NCBI-GeneID: 93
NCBI-ProteinID: NP_001097
OMIM: 602730
HGNC: 174
Ensembl: ENSG00000114739
Vega: OTTHUMG00000131291
Pharos: Q13705(Tchem)
UniProt: Q13705
Structure
LinkDB
Position
3:38453890..38493142
AA seq 512 aa
MTAPWVALALLWGSLCAGSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCY
ASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAG
GPEVTYEPPPTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYRHRKPPYGHVDIHEDPGPPP
PSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQDKQSWQSEREIFSTPGMK
HENLLQFIAAEKRGSNLEVELWLITAFHDKGSLTDYLKGNIITWNELCHVAETMSRGLSY
LHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQVG
TRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADGPVDEYMLPFEEEIGQ
HPSLEELQEVVVHKKMRPTIKDHWLKHPGLAQLCVTIEECWDHDAEARLSAGCVEERVSL
IRRSVNGTTSDCLVSLVTSVTNVDLPPKESSI
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgacggcgccctgggtggccctcgccctcctctggggatcgctgtgcgccggctctggg
cgtggggaggctgagacacgggagtgcatctactacaacgccaactgggagctggagcgc
accaaccagagcggcctggagcgctgcgaaggcgagcaggacaagcggctgcactgctac
gcctcctggcgcaacagctctggcaccatcgagctcgtgaagaagggctgctggctagat
gacttcaactgctacgataggcaggagtgtgtggccactgaggagaacccccaggtgtac
ttctgctgctgtgaaggcaacttctgcaacgaacgcttcactcatttgccagaggctggg
ggcccggaagtcacgtacgagccacccccgacagcccccaccctgctcacggtgctggcc
tactcactgctgcccatcgggggcctttccctcatcgtcctgctggccttttggatgtac
cggcatcgcaagcccccctacggtcatgtggacatccatgaggaccctgggcctccacca
ccatcccctctggtgggcctgaagccactgcagctgctggagatcaaggctcgggggcgc
tttggctgtgtctggaaggcccagctcatgaatgactttgtagctgtcaagatcttccca
ctccaggacaagcagtcgtggcagagtgaacgggagatcttcagcacacctggcatgaag
cacgagaacctgctacagttcattgctgccgagaagcgaggctccaacctcgaagtagag
ctgtggctcatcacggccttccatgacaagggctccctcacggattacctcaaggggaac
atcatcacatggaacgaactgtgtcatgtagcagagacgatgtcacgaggcctctcatac
ctgcatgaggatgtgccctggtgccgtggcgagggccacaagccgtctattgcccacagg
gactttaaaagtaagaatgtattgctgaagagcgacctcacagccgtgctggctgacttt
ggcttggctgttcgatttgagccagggaaacctccaggggacacccacggacaggtaggc
acgagacggtacatggctcctgaggtgctcgagggagccatcaacttccagagagatgcc
ttcctgcgcattgacatgtatgccatggggttggtgctgtgggagcttgtgtctcgctgc
aaggctgcagacggacccgtggatgagtacatgctgccctttgaggaagagattggccag
cacccttcgttggaggagctgcaggaggtggtggtgcacaagaagatgaggcccaccatt
aaagatcactggttgaaacacccgggcctggcccagctttgtgtgaccatcgaggagtgc
tgggaccatgatgcagaggctcgcttgtccgcgggctgtgtggaggagcgggtgtccctg
attcggaggtcggtcaacggcactacctcggactgtctcgtttccctggtgacctctgtc
accaatgtggacctgccccctaaagagtcaagcatctaa

DBGET integrated database retrieval system