KEGG   Homo sapiens (human): 134
Entry
134               CDS       T01001                                 

Gene name
ADORA1, RDC7
Definition
(RefSeq) adenosine A1 receptor
  KO
K04265  adenosine receptor A1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa05032  Morphine addiction
Drug target
Adenosine (DG00243): D00045<JP/US> D02300<JP> D02769 D08646 D08647
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Apaxifylline: D02964
Bamifylline (DG01064): D03051 D07491
Caffeine (DG00974): D00528<JP> D01453<JP> D07603<US>
Choline theophyllinate: D02017
Diprophylline: D00691<JP>
Enprofylline: D04006
Naxifylline: D05125
Proxyphylline: D01771<JP>
Rolofylline: D08989
Selodenoson: D05818
Tecadenoson: D06019
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Tonapofylline: D09684
Trabodenoson: D10493
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    134 (ADORA1)
   04024 cAMP signaling pathway
    134 (ADORA1)
   04022 cGMP-PKG signaling pathway
    134 (ADORA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    134 (ADORA1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    134 (ADORA1)
   04924 Renin secretion
    134 (ADORA1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    134 (ADORA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    134 (ADORA1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    134 (ADORA1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 134
NCBI-ProteinID: NP_000665
OMIM: 102775
HGNC: 262
Ensembl: ENSG00000163485
Vega: OTTHUMG00000042125
Pharos: P30542(Tclin)
UniProt: P30542
LinkDB
Structure
PDB: 
6D9H

Position
1q32.1
AA seq 326 aa
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
NT seq 981 nt   +upstreamnt  +downstreamnt
atgccgccctccatctcagctttccaggccgcctacatcggcatcgaggtgctcatcgcc
ctggtctctgtgcccgggaacgtgctggtgatctgggcggtgaaggtgaaccaggcgctg
cgggatgccaccttctgcttcatcgtgtcgctggcggtggctgatgtggccgtgggtgcc
ctggtcatccccctcgccatcctcatcaacattgggccacagacctacttccacacctgc
ctcatggttgcctgtccggtcctcatcctcacccagagctccatcctggccctgctggca
attgctgtggaccgctacctccgggtcaagatccctctccggtacaagatggtggtgacc
ccccggagggcggcggtggccatagccggctgctggatcctctccttcgtggtgggactg
acccctatgtttggctggaacaatctgagtgcggtggagcgggcctgggcagccaacggc
agcatgggggagcccgtgatcaagtgcgagttcgagaaggtcatcagcatggagtacatg
gtctacttcaacttctttgtgtgggtgctgcccccgcttctcctcatggtcctcatctac
ctggaggtcttctacctaatccgcaagcagctcaacaagaaggtgtcggcctcctccggc
gacccgcagaagtactatgggaaggagctgaagatcgccaagtcgctggccctcatcctc
ttcctctttgccctcagctggctgcctttgcacatcctcaactgcatcaccctcttctgc
ccgtcctgccacaagcccagcatccttacctacattgccatcttcctcacgcacggcaac
tcggccatgaaccccattgtctatgccttccgcatccagaagttccgcgtcaccttcctt
aagatttggaatgaccatttccgctgccagcctgcacctcccattgacgaggatctccca
gaagagaggcctgatgactag

KEGG   Homo sapiens (human): 140
Entry
140               CDS       T01001                                 

Gene name
ADORA3, A3AR
Definition
(RefSeq) adenosine A3 receptor
  KO
K04268  adenosine receptor A3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Adenosine (DG00243): D00045<JP/US> D02300<JP> D02769 D08646 D08647
Namodenoson: D11128
Piclidenoson: D10971
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    140 (ADORA3)
   04022 cGMP-PKG signaling pathway
    140 (ADORA3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    140 (ADORA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    140 (ADORA3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    140 (ADORA3)
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx PapG_N 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 140
NCBI-ProteinID: NP_000668
OMIM: 600445
HGNC: 268
Ensembl: ENSG00000282608
Vega: OTTHUMG00000011957
Pharos: P0DMS8(Tchem)
UniProt: P0DMS8
LinkDB
Position
1p13.2
AA seq 318 aa
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
NT seq 957 nt   +upstreamnt  +downstreamnt
atgcccaacaacagcactgctctgtcattggccaatgttacctacatcaccatggaaatt
ttcattggactctgcgccatagtgggcaacgtgctggtcatctgcgtggtcaagctgaac
cccagcctgcagaccaccaccttctatttcattgtctctctagccctggctgacattgct
gttggggtgctggtcatgcctttggccattgttgtcagcctgggcatcacaatccacttc
tacagctgcctttttatgacttgcctactgcttatctttacccacgcctccatcatgtcc
ttgctggccatcgctgtggaccgatacttgcgggtcaagcttaccgtcagatacaagagg
gtcaccactcacagaagaatatggctggccctgggcctttgctggctggtgtcattcctg
gtgggattgacccccatgtttggctggaacatgaaactgacctcagagtaccacagaaat
gtcaccttcctttcatgccaatttgtttccgtcatgagaatggactacatggtatacttc
agcttcctcacctggattttcatccccctggttgtcatgtgcgccatctatcttgacatc
ttttacatcattcggaacaaactcagtctgaacttatctaactccaaagagacaggtgca
ttttatggacgggagttcaagacggctaagtccttgtttctggttcttttcttgtttgct
ctgtcatggctgcctttatctatcatcaactgcatcatctactttaatggtgaggtacca
cagcttgtgctgtacatgggcatcctgctgtcccatgccaactccatgatgaaccctatc
gtctatgcctataaaataaagaagttcaaggaaacctaccttttgatcctcaaagcttgt
gtggtctgccatccctctgattctttggacacaagcattgagaagaattctgagtag

DBGET integrated database retrieval system