KEGG   Homo sapiens (human): 134
Entry
134               CDS       T01001                                 
Symbol
ADORA1, RDC7
Name
(RefSeq) adenosine A1 receptor
  KO
K04265  adenosine receptor A1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa05032  Morphine addiction
Drug target
Adenosine (DG00243): D00045<JP/US> D02300<JP> D02769 D08646 D08647
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Apaxifylline: D02964
Bamifylline (DG01064): D03051 D07491
Caffeine (DG00974): D00528<JP> D01453<JP> D07603<US>
Choline theophyllinate: D02017
Diprophylline: D00691<JP>
Enprofylline: D04006
Naxifylline: D05125
Proxyphylline: D01771<JP>
Rolofylline: D08989
Selodenoson: D05818
Tecadenoson: D06019
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Tonapofylline: D09684
Trabodenoson: D10493
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    134 (ADORA1)
   04024 cAMP signaling pathway
    134 (ADORA1)
   04022 cGMP-PKG signaling pathway
    134 (ADORA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    134 (ADORA1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    134 (ADORA1)
   04924 Renin secretion
    134 (ADORA1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    134 (ADORA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    134 (ADORA1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    134 (ADORA1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 134
NCBI-ProteinID: NP_000665
OMIM: 102775
HGNC: 262
Ensembl: ENSG00000163485
Pharos: P30542(Tclin)
UniProt: P30542
Structure
LinkDB
Position
1:203127726..203167405
AA seq 326 aa
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
NT seq 981 nt   +upstreamnt  +downstreamnt
atgccgccctccatctcagctttccaggccgcctacatcggcatcgaggtgctcatcgcc
ctggtctctgtgcccgggaacgtgctggtgatctgggcggtgaaggtgaaccaggcgctg
cgggatgccaccttctgcttcatcgtgtcgctggcggtggctgatgtggccgtgggtgcc
ctggtcatccccctcgccatcctcatcaacattgggccacagacctacttccacacctgc
ctcatggttgcctgtccggtcctcatcctcacccagagctccatcctggccctgctggca
attgctgtggaccgctacctccgggtcaagatccctctccggtacaagatggtggtgacc
ccccggagggcggcggtggccatagccggctgctggatcctctccttcgtggtgggactg
acccctatgtttggctggaacaatctgagtgcggtggagcgggcctgggcagccaacggc
agcatgggggagcccgtgatcaagtgcgagttcgagaaggtcatcagcatggagtacatg
gtctacttcaacttctttgtgtgggtgctgcccccgcttctcctcatggtcctcatctac
ctggaggtcttctacctaatccgcaagcagctcaacaagaaggtgtcggcctcctccggc
gacccgcagaagtactatgggaaggagctgaagatcgccaagtcgctggccctcatcctc
ttcctctttgccctcagctggctgcctttgcacatcctcaactgcatcaccctcttctgc
ccgtcctgccacaagcccagcatccttacctacattgccatcttcctcacgcacggcaac
tcggccatgaaccccattgtctatgccttccgcatccagaagttccgcgtcaccttcctt
aagatttggaatgaccatttccgctgccagcctgcacctcccattgacgaggatctccca
gaagagaggcctgatgactag

KEGG   Homo sapiens (human): 140
Entry
140               CDS       T01001                                 
Symbol
ADORA3, A3AR
Name
(RefSeq) adenosine A3 receptor
  KO
K04268  adenosine receptor A3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Adenosine (DG00243): D00045<JP/US> D02300<JP> D02769 D08646 D08647
Namodenoson: D11128
Piclidenoson: D10971
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    140 (ADORA3)
   04022 cGMP-PKG signaling pathway
    140 (ADORA3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    140 (ADORA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    140 (ADORA3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    140 (ADORA3)
SSDB
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx PapG_N
Other DBs
NCBI-GeneID: 140
NCBI-ProteinID: NP_000668
OMIM: 600445
HGNC: 268
Ensembl: ENSG00000282608
Pharos: P0DMS8(Tchem)
UniProt: P0DMS8
LinkDB
Position
1:complement(111499429..111503633)
AA seq 318 aa
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
NT seq 957 nt   +upstreamnt  +downstreamnt
atgcccaacaacagcactgctctgtcattggccaatgttacctacatcaccatggaaatt
ttcattggactctgcgccatagtgggcaacgtgctggtcatctgcgtggtcaagctgaac
cccagcctgcagaccaccaccttctatttcattgtctctctagccctggctgacattgct
gttggggtgctggtcatgcctttggccattgttgtcagcctgggcatcacaatccacttc
tacagctgcctttttatgacttgcctactgcttatctttacccacgcctccatcatgtcc
ttgctggccatcgctgtggaccgatacttgcgggtcaagcttaccgtcagatacaagagg
gtcaccactcacagaagaatatggctggccctgggcctttgctggctggtgtcattcctg
gtgggattgacccccatgtttggctggaacatgaaactgacctcagagtaccacagaaat
gtcaccttcctttcatgccaatttgtttccgtcatgagaatggactacatggtatacttc
agcttcctcacctggattttcatccccctggttgtcatgtgcgccatctatcttgacatc
ttttacatcattcggaacaaactcagtctgaacttatctaactccaaagagacaggtgca
ttttatggacgggagttcaagacggctaagtccttgtttctggttcttttcttgtttgct
ctgtcatggctgcctttatctatcatcaactgcatcatctactttaatggtgaggtacca
cagcttgtgctgtacatgggcatcctgctgtcccatgccaactccatgatgaaccctatc
gtctatgcctataaaataaagaagttcaaggaaacctaccttttgatcctcaaagcttgt
gtggtctgccatccctctgattctttggacacaagcattgagaagaattctgagtag

KEGG   Homo sapiens (human): 4985
Entry
4985              CDS       T01001                                 
Symbol
OPRD1, DOP, DOR, DOR1, OPRD
Name
(RefSeq) opioid receptor delta 1
  KO
K04213  delta-type opioid receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H01703  Eating Disorders
Drug target
Eluxadoline: D10403<US>
Etorphine: D07937
Ketobemidone (DG00815): D08100 D08101
Levallorphan tartrate: D02238<JP>
Loperamide (DG00092): D00729<JP/US> D08144
Loperamide oxide (DG00092): D07113
Metkephamid acetate: D05007
Nalbuphine (DG00822): D00843<US> D08246
Nalmefene (DG00998): D02104<US> D05111 D10812<JP>
Naloxone (DG01155): D01340<JP/US> D08249 D11620<US>
Naltrexone (DG00997): D02095<US> D05113<US>
Oxycodone (DG00813): D00847<US> D03783 D05312<US> D05462<JP>
Quadazocine mesylate: D05667
Tonazocine mesylate: D06189
Xorphanol mesylate: D06342
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    4985 (OPRD1)
   04022 cGMP-PKG signaling pathway
    4985 (OPRD1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    4985 (OPRD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    4985 (OPRD1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Opioid
    4985 (OPRD1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Other DBs
NCBI-GeneID: 4985
NCBI-ProteinID: NP_000902
OMIM: 165195
HGNC: 8153
Ensembl: ENSG00000116329
Pharos: P41143(Tclin)
UniProt: P41143
Structure
LinkDB
Position
1:28812170..28871267
AA seq 372 aa
MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggaaccggccccctccgccggcgccgagctgcagcccccgctcttcgccaacgcctcg
gacgcctaccctagcgcctgccccagcgctggcgccaatgcgtcggggccgccaggcgcg
cggagcgcctcgtccctcgccctggcaatcgccatcaccgcgctctactcggccgtgtgc
gccgtggggctgctgggcaacgtgcttgtcatgttcggcatcgtccggtacactaagatg
aagacggccaccaacatctacatcttcaacctggccttagccgatgcgctggccaccagc
acgctgcctttccagagtgccaagtacctgatggagacgtggcccttcggcgagctgctc
tgcaaggctgtgctctccatcgactactacaatatgttcaccagcatcttcacgctcacc
atgatgagtgttgaccgctacatcgctgtctgccaccctgtcaaggccctggacttccgc
acgcctgccaaggccaagctgatcaacatctgtatctgggtcctggcctcaggcgttggc
gtgcccatcatggtcatggctgtgacccgtccccgggacggggcagtggtgtgcatgctc
cagttccccagccccagctggtactgggacacggtgaccaagatctgcgtgttcctcttc
gccttcgtggtgcccatcctcatcatcaccgtgtgctatggcctcatgctgctgcgcctg
cgcagtgtgcgcctgctgtcgggctccaaggagaaggaccgcagcctgcggcgcatcacg
cgcatggtgctggtggttgtgggcgccttcgtggtgtgttgggcgcccatccacatcttc
gtcatcgtctggacgctggtggacatcgaccggcgcgacccgctggtggtggctgcgctg
cacctgtgcatcgcgctgggctacgccaatagcagcctcaaccccgtgctctacgctttc
ctcgacgagaacttcaagcgctgcttccgccagctctgccgcaagccctgcggccgccca
gaccccagcagcttcagccgcgcccgcgaagccacggcccgcgagcgtgtcaccgcctgc
accccgtccgatggtcccggcggtggcgctgccgcctga

KEGG   Homo sapiens (human): 624
Entry
624               CDS       T01001                                 
Symbol
BDKRB2, B2R, BK-2, BK2, BKR2, BRB2
Name
(RefSeq) bradykinin receptor B2
  KO
K03916  bradykinin receptor B2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04810  Regulation of actin cytoskeleton
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05142  Chagas disease
hsa05200  Pathways in cancer
Network
nt06514  Coagulation cascade
  Element
N01517  Kallikrein-kinin system, HMWK to bradykinin
Drug target
Deltibant: D03677
Icatibant: D04492<JP/US>
Labradimil: D08937
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    624 (BDKRB2)
   04071 Sphingolipid signaling pathway
    624 (BDKRB2)
   04022 cGMP-PKG signaling pathway
    624 (BDKRB2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    624 (BDKRB2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    624 (BDKRB2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    624 (BDKRB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    624 (BDKRB2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    624 (BDKRB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    624 (BDKRB2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    624 (BDKRB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    624 (BDKRB2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Bradykinin
    624 (BDKRB2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 624
NCBI-ProteinID: NP_000614
OMIM: 113503
HGNC: 1030
Ensembl: ENSG00000168398
Pharos: P30411(Tclin)
UniProt: P30411
Structure
LinkDB
Position
14:96204839..96244164
AA seq 391 aa
MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
PPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNN
FDWLFGETLCRVVNAIISMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLV
IWGCTLLLSSPMLVFRTMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVI
TFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGI
LSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEP
IQMENSMGTLRTSISVERQIHKLQDWAGSRQ
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgttctctccctggaagatatcaatgtttctgtctgttcgtgaggactccgtgcccacc
acggcctctttcagcgccgacatgctcaatgtcaccttgcaagggcccactcttaacggg
acctttgcccagagcaaatgcccccaagtggagtggctgggctggctcaacaccatccag
ccccccttcctctgggtgctgttcgtgctggccaccctagagaacatctttgtcctcagc
gtcttctgcctgcacaagagcagctgcacggtggcagagatctacctggggaacctggcc
gcagcagacctgatcctggcctgcgggctgcccttctgggccatcaccatctccaacaac
ttcgactggctctttggggagacgctctgccgcgtggtgaatgccattatctccatgaac
ctgtacagcagcatctgtttcctgatgctggtgagcatcgaccgctacctggccctggtg
aaaaccatgtccatgggccggatgcgcggcgtgcgctgggccaagctctacagcttggtg
atctgggggtgtacgctgctcctgagctcacccatgctggtgttccggaccatgaaggag
tacagcgatgagggccacaacgtcaccgcttgtgtcatcagctacccatccctcatctgg
gaagtgttcaccaacatgctcctgaatgtcgtgggcttcctgctgcccctgagtgtcatc
accttctgcacgatgcagatcatgcaggtgctgcggaacaacgagatgcagaagttcaag
gagatccagacagagaggagggccacggtgctagtcctggttgtgctgctgctattcatc
atctgctggctgcccttccagatcagcaccttcctggatacgctgcatcgcctcggcatc
ctctccagctgccaggacgagcgcatcatcgatgtaatcacacagatcgcctccttcatg
gcctacagcaacagctgcctcaacccactggtgtacgtgatcgtgggcaagcgcttccga
aagaagtcttgggaggtgtaccagggagtgtgccagaaagggggctgcaggtcagaaccc
attcagatggagaactccatgggcacactgcggacctccatctccgtggaacgccagatt
cacaaactgcaggactgggcagggagcagacagtga

DBGET integrated database retrieval system