KEGG   Homo sapiens (human): 134111
Entry
134111            CDS       T01001                                 
Symbol
UBE2QL1
Name
(RefSeq) ubiquitin conjugating enzyme E2 Q family like 1
  KO
K10582  ubiquitin-conjugating enzyme E2 Q [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    134111 (UBE2QL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    134111 (UBE2QL1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     134111 (UBE2QL1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   134111 (UBE2QL1)
SSDB
Motif
Pfam: UQ_con
Other DBs
NCBI-GeneID: 134111
NCBI-ProteinID: NP_001138633
OMIM: 615832
HGNC: 37269
Ensembl: ENSG00000215218
Pharos: A1L167(Tbio)
UniProt: A1L167
LinkDB
Position
5:6448859..6496723
AA seq 161 aa
MKELQDIARLSDRFISVELVDESLFDWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPD
NFPFSPPFMRVLSPRLENGYVLDGGAICMELLTPRGWSSAYTVEAVMRQFAASLVKGQGR
ICRKAGKSKKSFSRKEAEATFKSLVKTHEKYGWVTPPVSDG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaaggagctgcaggacatcgcgcgccttagcgaccgcttcatctccgtggagctggtg
gacgagagcctgttcgactggaacgtgaagctgcaccaggtggacaaggactcggtgctg
tggcaggacatgaaggagaccaacaccgagttcatcctgctcaacctcaccttccccgac
aacttccccttctcgccgcccttcatgcgggtgctcagcccgcgcctggagaacggctac
gtgctggacggcggcgccatctgcatggagctgctcacgccgcgcggctggtccagcgcc
tacaccgtggaggccgtcatgcgccagttcgcagccagcctggtcaagggccagggacgg
atctgtagaaaagctggcaaatcaaaaaagtccttcagtcgcaaggaagctgaagctacc
tttaagagtttggtgaagacgcatgaaaaatatggttgggtcaccccgcccgtgtccgac
ggctga

KEGG   Homo sapiens (human): 55585
Entry
55585             CDS       T01001                                 
Symbol
UBE2Q1, GTAP, NICE-5, NICE5, PRO3094, UBE2Q
Name
(RefSeq) ubiquitin conjugating enzyme E2 Q1
  KO
K10582  ubiquitin-conjugating enzyme E2 Q [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    55585 (UBE2Q1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    55585 (UBE2Q1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     55585 (UBE2Q1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   55585 (UBE2Q1)
SSDB
Motif
Pfam: UQ_con RWD Josephin Hmw_CFAP97
Other DBs
NCBI-GeneID: 55585
NCBI-ProteinID: NP_060052
OMIM: 617429
HGNC: 15698
Ensembl: ENSG00000160714
Pharos: Q7Z7E8(Tbio)
UniProt: Q7Z7E8
Structure
LinkDB
Position
1:complement(154548577..154558662)
AA seq 422 aa
MQQPQPQGQQQPGPGQQLGGQGAAPGAGGGPGGGPGPGPCLRRELKLLESIFHRGHERFR
IASACLDELSCEFLLAGAGGAGAGAAPGPHLPPRGSVPGDPVRIHCNITESYPAVPPIWS
VESDDPNLAAVLERLVDIKKGNTLLLQHLKRIISDLCKLYNLPQHPDVEMLDQPLPAEQC
TQEDVSSEDEDEEMPEDTEDLDHYEMKEEEPAEGKKSEDDGIGKENLAILEKIKKNQRQD
YLNGAVSGSVQATDRLMKELRDIYRSQSFKGGNYAVELVNDSLYDWNVKLLKVDQDSALH
NDLQILKEKEGADFILLNFSFKDNFPFDPPFVRVVSPVLSGGYVLGGGAICMELLTKQGW
SSAYSIESVIMQISATLVKGKARVQFGANKSQYSLTRAQQSYKSLVQIHEKNGWYTPPKE
DG
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgcagcagccgcagccgcaggggcagcagcagccggggccggggcagcagctggggggc
cagggggcggcgccgggggccgggggcggcccaggggggggcccggggccggggccctgc
ctgaggcgagagctgaagctgctcgagtccatcttccaccgcggccacgagcgcttccgc
attgccagcgcctgcctggacgagctgagctgcgagttcctgctggctggggccggaggg
gccggggcgggggccgcgcccggaccgcatctccccccacgggggtcggtgcctggggat
cctgtccgcatccactgcaacatcacggagtcataccctgctgtgccccccatctggtcg
gtggagtctgatgaccctaacttggctgctgtcttggagaggctggtggacataaagaaa
gggaatactctgctattgcagcatctgaagaggatcatctccgacctgtgtaaactctat
aacctccctcagcatccagatgtggagatgctggatcaacccttgccagcagagcagtgc
acacaggaagacgtgtcttcagaagatgaagatgaggagatgcctgaggacacagaagac
ttagatcactatgaaatgaaagaggaagagccagctgagggcaagaaatctgaagatgat
ggcattggaaaagaaaacttggccatcctagagaaaattaaaaagaaccagaggcaagat
tacttaaatggtgcagtgtctggctcggtgcaggccactgaccggctgatgaaggagctc
agggatatataccgatcacagagtttcaaaggcggaaactatgcagtcgaactcgtgaat
gacagtctgtatgattggaatgtcaaactcctcaaagttgaccaggacagcgctttgcac
aacgatctccagatcctcaaagagaaagaaggagccgacttcattctacttaacttttcc
tttaaagataactttccctttgacccaccatttgtcagggttgtgtctccagtcctctct
ggagggtatgttctgggcggaggggccatctgcatggaacttctcaccaaacagggctgg
agcagtgcctactccatagagtcagtgatcatgcagatcagtgccacactggtgaagggg
aaagcacgagtgcagtttggagccaacaaatctcaatacagtctgacaagagcacagcag
tcctacaagtccttggtgcagatccacgaaaaaaacggctggtacacacccccaaaagaa
gacggctaa

KEGG   Homo sapiens (human): 92912
Entry
92912             CDS       T01001                                 
Symbol
UBE2Q2
Name
(RefSeq) ubiquitin conjugating enzyme E2 Q2
  KO
K10582  ubiquitin-conjugating enzyme E2 Q [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    92912 (UBE2Q2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    92912 (UBE2Q2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     92912 (UBE2Q2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   92912 (UBE2Q2)
SSDB
Motif
Pfam: UQ_con RWD Josephin DUF6664 CDC45 DUF6449
Other DBs
NCBI-GeneID: 92912
NCBI-ProteinID: NP_775740
OMIM: 612501
HGNC: 19248
Ensembl: ENSG00000140367
Pharos: Q8WVN8(Tbio)
UniProt: Q8WVN8
Structure
LinkDB
Position
15:75843447..75901078
AA seq 375 aa
MSVSGLKAELKFLASIFDKNHERFRIVSWKLDELHCQFLVPQQGSPHSLPPPLTLHCNIT
ESYPSSSPIWFVDSEDPNLTSVLERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEM
LDQPLPTGQNGTTEEVTSEEEEEEEEMAEDIEDLDHYEMKEEEPISGKKSEDEGIEKENL
AILEKIRKTQRQDHLNGAVSGSVQASDRLMKELRDIYRSQSYKTGIYSVELINDSLYDWH
VKLQKVDPDSPLHSDLQILKEKEGIEYILLNFSFKDNFPFDPPFVRVVLPVLSGGYVLGG
GALCMELLTKQGWSSAYSIESVIMQINATLVKGKARVQFGANKNQYNLARAQQSYNSIVQ
IHEKNGWYTPPKEDG
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgtccgtgtcagggctcaaggccgagctgaagttcctggcgtccatcttcgacaagaac
cacgagcgattccgcatcgtcagttggaagctggacgagctgcactgccagttcctggtg
ccgcagcagggcagcccgcactcgctgccgccgccactcacgctccactgcaacatcacg
gaatcctatccatcttcttcaccgatatggtttgtggattctgaagacccaaatctgaca
tcagttctggaacgtctagaagatactaagaacaacaatttgcttcgtcagcaattgaag
tggttgatatgtgaactctgcagtttatataaccttcctaagcacctggatgttgagatg
ctagatcaaccactacccacgggtcagaatgggacaacagaagaagtgacttcagaagaa
gaggaagaagaagaagagatggctgaagatatagaagacttagatcactatgagatgaag
gaagaagagcctattagtgggaaaaagtcagaggatgaaggaattgaaaaagaaaatttg
gcaatattagagaaaattaggaagactcaaaggcaagaccatttaaatggtgcagtgtct
gggtcagtgcaagcttcagatagacttatgaaagagctcagggacatatacagatcacag
agttataaaacagggatttattcagtggaactcataaatgacagtttatatgactggcat
gttaaactgcagaaggttgaccctgatagtcctttgcacagtgatcttcagatcttaaaa
gaaaaagaaggcatagaatatattttgcttaacttctcttttaaggataactttccattt
gatcctccatttgttcgagtggtgttacctgttctctcaggagggtatgtattgggtgga
ggagcattatgtatggaacttctcacaaaacagggctggagcagtgcctactcaatagaa
tcggtcatcatgcaaataaatgccaccttagtcaaaggcaaagccagagtgcagtttgga
gcaaataagaatcaatataatctagcaagagcccaacaatcctataattccattgtacag
atacatgagaaaaatggctggtacacccctccaaaggaagatggctaa

DBGET integrated database retrieval system