KEGG   Homo sapiens (human): 134430
Entry
134430            CDS       T01001                                 
Symbol
WDR36, GLC1G, TA-WDRP, TAWDRP, UTP21
Name
(RefSeq) WD repeat domain 36
  KO
K14554  U3 small nucleolar RNA-associated protein 21
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Disease
H00612  Primary open angle glaucoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    134430 (WDR36)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    134430 (WDR36)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    134430 (WDR36)
SSDB
Motif
Pfam: Utp21 WD40 ANAPC4_WD40 eIF2A WD40_like Utp12
Other DBs
NCBI-GeneID: 134430
NCBI-ProteinID: NP_644810
OMIM: 609669
HGNC: 30696
Ensembl: ENSG00000134987
Vega: OTTHUMG00000128790
Pharos: Q8NI36(Tbio)
UniProt: Q8NI36
Structure
LinkDB
Position
5:111092348..111130502
AA seq 895 aa
MERASERRTASALFAGFRALGLFSNDIPHVVRFSALKRRFYVTTCVGKSFHTYDVQKLSL
VAVSNSVPQDICCMAADGRLVFAAYGNVFSAFARNKEIVHTFKGHKAEIHFLQPFGDHII
SVDTDGILIIWHIYSEEEYLQLTFDKSVFKISAILHPSTYLNKILLGSEQGSLQLWNVKS
NKLLYTFPGWKVGVTALQQAPAVDVVAIGLMSGQVIIHNIKFNETLMKFRQDWGPITSIS
FRTDGHPVMAAGSPCGHIGLWDLEDKKLINQMRNAHSTAIAGLTFLHREPLLVTNGADNA
LRIWIFDGPTGEGRLLRFRMGHSAPLTNIRYYGQNGQQILSASQDGTLQSFSTVHEKFNK
SLGHGLINKKRVKRKGLQNTMSVRLPPITKFAAEEARESDWDGIIACHQGKLSCSTWNYQ
KSTIGAYFLKPKELKKDDITATAVDITSCGNFAVIGLSSGTVDVYNMQSGIHRGSFGKDQ
AHKGSVRGVAVDGLNQLTVTTGSEGLLKFWNFKNKILIHSVSLSSSPNIMLLHRDSGILG
LALDDFSISVLDIETRKIVREFSGHQGQINDMAFSPDGRWLISAAMDCSIRTWDLPSGCL
IDCFLLDSAPLNVSMSPTGDFLATSHVDHLGIYLWSNISLYSVVSLRPLPADYVPSIVML
PGTCQTQDVEVSEETVEPSDELIEYDSPEQLNEQLVTLSLLPESRWKNLLNLDVIKKKNK
PKEPPKVPKSAPFFIPTIPGLVPRYAAPEQNNDPQQSKVVNLGVLAQKSDFCLKLEEGLV
NNKYDTALNLLKESGPSGIETELRSLSPDCGGSIEVMQSFLKMIGMMLDRKRDFELAQAY
LALFLKLHLKMLPSEPVLLEEITNLSSQVEENWTHLQSLFNQSMCILNYLKSALL
NT seq 2688 nt   +upstreamnt  +downstreamnt
atggaacgggcctcagaaaggcgcacggccagcgcgctttttgcggggttccgggccttg
ggacttttcagcaacgacattccacacgtggtgcggttcagcgcgctcaagcgccggttc
tatgtaacaacctgcgtgggcaagagtttccacacctatgacgttcagaaacttagtctg
gttgcagtaagtaattctgttccacaggatatctgctgtatggcagctgatggcagatta
gtctttgctgcttatggaaatgttttctctgcatttgcccgtaataaagagatagtacat
acctttaagggtcataaggcagaaatccatttcttgcaaccctttggagaccacattatc
tctgttgatactgatggcattcttattatttggcacatatattcagaagaagaatacctg
cagttgacttttgataaatcagtatttaaaatttctgcaattttgcatccaagtacctac
ttgaataaaatacttctgggcagtgaacaaggaagcctgcagttgtggaatgtaaaatcc
aataaacttctatatacatttccaggatggaaagttggagtgacagctcttcagcaggca
ccagccgtggatgttgttgctattggtcttatgtcaggtcaagttatcattcacaacatt
aaatttaatgaaacattaatgaagtttcgtcaagactggggacccattacttcaatttca
tttcgcacagatggtcatccagtaatggcagctggaagcccatgtggccatattggactc
tgggatctagaagacaaaaaattaatcaaccaaatgagaaatgcacactctacagcaatt
gccggactgacatttctccatagagagccacttcttgtcacaaatggcgctgacaatgct
cttaggatatggatatttgatggtcctacaggtgaaggccgacttttgagattcagaatg
ggtcatagtgctcctcttaccaatatcagatattatggacagaatggacagcagattcta
agtgcaagtcaagatggaactcttcagtcattttccacggtacatgaaaaattcaataag
agcttgggacatggattaataaataaaaagagagttaaacgtaaaggacttcagaatacc
atgtcagtgagacttccacccatcacaaagtttgcagcagaggaagctcgtgaaagtgac
tgggatggtatcattgcttgccatcaaggtaagctatcttgctcaacctggaattatcag
aaatctacaataggcgcttactttctcaagccaaaagagttgaagaaagatgacataact
gcaacagcagtggatataacttcttgtggaaactttgctgtaattggcctctcatcagga
actgtagatgtatataacatgcagtctggcatacatcgaggaagttttggcaaggatcaa
gctcacaagggatctgttagaggtgtcgcagtggatggattaaaccagttgacagttaca
actggtagtgaaggattactcaaattctggaactttaaaaacaaaattttaatccattct
gtgagcctcagttcatctccaaatatcatgttgctacatagggacagtggcattctggga
ctcgccttggatgacttctccattagtgttctggacatagaaactaggaagattgtcaga
gagttttctggacaccaaggccaaataaatgacatggcttttagtcctgatggtcgttgg
ttaataagtgctgcgatggattgctctattaggacttgggaccttccttctgggtgcctt
atagactgctttttgttggactcggctcctctcaatgtttctatgtctcctactggagac
tttctggcaacttcccatgtggaccaccttggaatttatctatggtccaatatttccctg
tattcagttgtttcattacggccacttcctgcagattatgtcccttcaatagtcatgctt
cctggtacttgtcaaacccaagatgtagaagtatcagaagaaacagtagaaccaagtgat
gaattgatagaatatgattcgccagaacagttgaatgagcaattggtgactctttcactt
cttcctgaatcacgatggaaaaaccttcttaaccttgatgttattaagaaaaagaataaa
ccaaaggaaccacccaaagtacccaaatcagcaccatttttcattccaacaattcctggc
cttgtacccagatatgctgcacctgaacaaaataatgatccccagcagtctaaagtggta
aatcttggagttttggctcaaaaatcagatttctgcttgaaacttgaagaaggactggta
aataataagtatgacactgctctcaaccttctgaaagaatcaggcccatcaggaattgaa
acagagctgcgaagcttgtctcctgattgtggtgggtccatagaagttatgcagagcttc
ttgaaaatgattgggatgatgctggacagaaagcgtgattttgagttagcccaggcatac
cttgcattgtttctaaagttacaccttaaaatgcttccttcagagccagtactcctagaa
gaaataacaaatttgtcatcccaggtggaagaaaactggacccatttgcaatcactcttc
aatcaaagcatgtgtattttaaattatctcaaaagtgctttgttgtaa

DBGET integrated database retrieval system