KEGG   Homo sapiens (human): 1408
Entry
1408              CDS       T01001                                 
Symbol
CRY2, HCRY2, PHLL2
Name
(RefSeq) cryptochrome circadian regulator 2
  KO
K02295  cryptochrome
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    1408 (CRY2)
SSDB
Motif
Pfam: FAD_binding_7 DNA_photolyase Peripla_BP_6 ROQ_II
Other DBs
NCBI-GeneID: 1408
NCBI-ProteinID: NP_066940
OMIM: 603732
HGNC: 2385
Ensembl: ENSG00000121671
Pharos: Q49AN0(Tbio)
UniProt: Q49AN0 A0A0D2X7Z3 A2I2P1
LinkDB
Position
11:45847118..45883244
AA seq 593 aa
MAATVATAAAVAPAPAPGTDSASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWF
AASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYD
SEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRME
LPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQGGETEALARL
DKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNST
PPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWID
AIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLS
CSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCI
IGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQ
AGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggcggcgactgtggcgacggcggcagctgtggccccggcgccagcgcccggcacggac
agcgcctcttcggtgcactggttccgcaaagggctgcgactccacgacaacccggcgttg
ctggcggccgtgcgcggggcgcgctgcgtgcgctgcgtttacattctcgacccgtggttc
gcggcctcctcctcagtcgggatcaaccgatggaggttcctacttcagtctctggaagat
ttggacacaagtttaaggaaactgaactcccgcctgtttgtagtccggggacagccagcc
gacgtgttcccaaggctgttcaaggaatggggagtgacccgcttgacctttgaatatgac
tctgaaccctttgggaaagaacgggatgcagccatcatgaagatggccaaggaggctggt
gtggaagtagtgacggagaattctcataccctctatgacctggacaggatcattgagctg
aatgggcagaagccaccccttacatacaagcgctttcaggccatcatcagccgcatggag
ctgcccaagaagccagtgggcttggtgaccagccagcagatggagagctgcagggccgag
atccaggagaaccacgacgagacctacggcgtgccctccctggaggagctggggttcccc
actgaaggacttggtccagctgtctggcagggaggagagacagaagctctggcccgcctg
gataagcacttggaacggaaggcctgggttgccaactatgagagaccccgaatgaacgcc
aactccctcctggccagccccacaggcctcagcccctacctgcgctttggttgtctctcc
tgccgcctcttctactaccgcctgtgggacctgtataaaaaggtgaagcggaacagcaca
cctcccctctccctatttgggcaactcctatggcgagagttcttctacacggcagctacc
aacaaccccaggtttgaccgcatggaggggaaccccatctgcatccagatcccctgggac
cgcaatcctgaggccctggccaagtgggctgagggcaagacaggcttcccttggattgat
gccatcatgacccaactgaggcaggagggctggatccaccacctggcccggcatgccgtg
gcctgcttcctgacccgcggggacctctgggtcagctgggagagcggggtccgggtattt
gatgagctgctcctggatgcagatttcagcgtgaacgcaggcagctggatgtggctgtcc
tgcagtgctttcttccagcagttcttccactgctactgccctgtgggctttggccgtcgc
acggaccccagtggggactacatcaggcgatacctgcccaaattgaaagcgttcccctct
cgatacatctatgagccctggaatgccccagagtcaattcagaaggcagccaagtgcatc
attggtgtggactacccacggcccatcgtcaaccatgccgagaccagccggcttaacatt
gaacgaatgaagcagatttaccagcagctttcgcgctaccggggactctgtctactggca
tctgtcccttcctgtgtggaagacctcagtcaccctgtggcagagcccagctcgagccag
gctggcagcatgagcagtgcaggcccaagaccactacccagtggcccagcatcccccaaa
cgcaagctggaagcagccgaggaaccacctggtgaagaactcagcaaacgggcccgggtg
gcagagttgccaaccccagagctgccgagcaaggatgcctga

DBGET integrated database retrieval system