KEGG   Homo sapiens (human): 142678
Entry
142678            CDS       T01001                                 
Symbol
MIB2, ZZANK1, ZZZ5
Name
(RefSeq) MIB E3 ubiquitin protein ligase 2
  KO
K10645  E3 ubiquitin-protein ligase mind-bomb [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    142678 (MIB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    142678 (MIB2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     142678 (MIB2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    142678 (MIB2)
SSDB
Motif
Pfam: MIB_HERC2 Ank_5 Ank_2 SH3_15 Ank_4 Ank Ank_3 zf-C3HC4_3 ZZ zf-C3HC4_2
Other DBs
NCBI-GeneID: 142678
NCBI-ProteinID: NP_001164158
OMIM: 611141
HGNC: 30577
Ensembl: ENSG00000197530
Pharos: Q96AX9(Tbio)
UniProt: Q96AX9
LinkDB
Position
1:1613731..1630605
AA seq 955 aa
MDPDPQAGVQVGMRVVRGVDWKWGQQDGGEGGVGTVVELGRHGSPSTPDRTVVVQWDQGT
RTNYRAGYQGAHDLLLYDNAQIGVRHPNIICDCCKKHGLRGMRWKCRVCLDYDLCTQCYM
HNKHELAHAFDRYETAHSRPVTLSPRQGLPRIPLRGIFQGAKVVRGPDWEWGSQDGGEGK
PGRVVDIRGWDVETGRSVASVTWADGTTNVYRVGHKGKVDLKCVGEAAGGFYYKDHLPRL
GKPAELQRRVSADSQPFQHGDKVKCLLDTDVLREMQEGHGGWNPRMAEFIGQTGTVHRIT
DRGDVRVQFNHETRWTFHPGALTKHHSFWVGDVVRVIGDLDTVKRLQAGHGEWTDDMAPA
LGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVAL
DKLRAQKSDPEHPGRLVVEVALGNAARALDLLRRRPEQVDTKNQGRTALQVAAYLGQVEL
IRLLLQARAGVDLPDDEGNTALHYAALGNQPEATRVLLSAGCRADAINSTQSTALHVAVQ
RGFLEVVRALCERGCDVNLPDAHSDTPLHSAISAGTGASGIVEVLTEVPNIDVTATNSQG
FTLLHHASLKGHALAVRKILARARQLVDAKKEDGFTALHLAALNNHREVAQILIREGRCD
VNVRNRKLQSPLHLAVQQAHVGLVPLLVDAGCSVNAEDEEGDTALHVALQRHQLLPLVAD
GAGGDPGPLQLLSRLQASGLPGSAELTVGAAVACFLALEGADVSYTNHRGRSPLDLAAEG
RVLKALQGCAQRFRERQAGGGAAPGPRQTLGTPNTVTNLHVGAAPGPEAAECLVCSELAL
LVLFSPCQHRTVCEECARRMKKCIRCQVVVSKKLRPDGSEVASAAPAPGPPRQLVEELQS
RYRQMEERITCPICIDSHIRLVFQCGHGACAPCGSALSACPICRQPIRDRIQIFV
NT seq 2868 nt   +upstreamnt  +downstreamnt
atggacccagacccccaggcgggcgtgcaggtgggcatgcgggtggtgcgcggcgtggac
tggaagtggggccagcaggacggcggcgagggcggcgtgggcacggtggtggagcttggc
cgccacggcagcccctcgacacccgaccgcacagtggtcgtgcagtgggaccagggcacg
cgcaccaactaccgcgccggctaccagggcgcgcacgacctgctgctgtacgacaacgcc
cagatcggcgtccggcaccccaacatcatctgtgactgctgcaagaagcacgggctgcgg
gggatgcgctggaagtgccgtgtgtgcctggactacgacctctgcacgcagtgctacatg
cacaacaagcatgagctcgcccacgccttcgaccgctacgagaccgctcactcgcgccct
gtcacactgagtccccgccagggcctcccgaggatcccactaaggggcatcttccaggga
gcgaaggtggtgcgaggccccgactgggagtggggctcacaggatggaggggaagggaaa
ccgggccgtgtggtggacatccgtggctgggatgtggagacaggccggagtgtggccagc
gtgacgtgggctgatggtaccaccaatgtgtaccgtgtgggccacaagggcaaggtggac
ctcaagtgtgtgggcgaggcagcgggcggcttctactacaaggaccacctcccaaggctc
ggcaagccggcggagctgcagcgcagggtgagtgctgacagccagcccttccagcacggg
gacaaggtcaagtgtctgctggacactgatgtcctgcgggagatgcaggaaggccacggc
ggctggaaccccaggatggcggagtttatcggacagacgggcaccgtgcatcgtatcacg
gaccgcggggacgtgcgcgtgcagttcaaccacgagacgcgctggaccttccaccccggg
gcgctcaccaagcaccactccttctgggtgggcgacgtggtccgggtcatcggcgacctt
gacacagtgaagcggctgcaggctgggcatggcgagtggacggacgacatggcccctgcc
ctgggccgcgtcgggaaggtggtgaaagtgtttggagacgggaacctgcgtgtagcagtc
gctggtcagcggtggaccttcagcccctcctgcctggtggcctaccggcccgaggaggat
gccaacctggacgtggccgagcgcgcccgggagaacaaaagctcactgagcgtggccctg
gacaagcttcgggcccagaagagtgacccagagcacccgggaaggctggtggtggaggtg
gcgctgggtaacgcagcccgggctctggacctgctgcggaggcgcccagagcaggtggac
accaagaaccaaggcaggaccgctctgcaagtggctgcctacctgggccaggtggagttg
atacggctgctgctacaagccagggcgggcgtggacctgccggacgacgagggcaacacg
gcactgcactacgcggccctggggaaccagcccgaggccaccagggtgctcctgagtgct
gggtgccgggcggacgccatcaacagcacccagagcacagcactgcacgtggccgtgcag
aggggcttcctggaggtggtgcgggccctgtgtgagcgcggctgtgacgtcaacctgccc
gacgcccactcggacacgcccctgcactccgccatctcggcgggcactggagccagcggc
attgtcgaggtcctcacggaggtgccaaacatcgatgttaccgccaccaacagccagggt
ttcaccctgctgcaccatgcctccctcaagggtcacgcgctagctgtgagaaagattctg
gctcgggcgcggcagctggtggacgccaagaaggaggacggcttcacggcgctgcatctg
gctgccctcaacaaccaccgcgaggtggcccagatcctcatccgggagggccgctgtgac
gtgaacgtgcgcaaccggaagctgcagtccccgctgcatctcgccgtgcaacaggcccac
gtggggctggtgccgctactggtggacgctgggtgcagtgtcaacgccgaggacgaggag
ggggacacagccctgcacgtggcgctgcagcgtcatcagctgctgcccctggtggctgat
ggggccgggggggacccagggcccttgcagctgctgtccaggctacaggcctcgggcctc
cccggcagcgcggagctgacggtgggcgcggcggtcgcctgcttcctggcgctggagggc
gccgacgtgagctacaccaaccaccgcggtcggagcccgctggacctggccgccgagggt
cgcgtgctcaaggcccttcagggctgcgcccagcgcttccgggagcggcaggcgggcggg
ggcgcggccccgggccccaggcaaacgctcgggacccccaacaccgtgacgaacctgcac
gtgggcgccgcgccggggcccgaggccgctgagtgcctggtgtgctccgagctggcgctg
ctggtgctgttctcgccgtgccagcaccgcaccgtgtgtgaggagtgcgcgcgcaggatg
aagaagtgcatcaggtgccaggtggtcgtcagcaagaaactgcgcccagacggctctgag
gtggcgagcgccgcccccgcccccggcccgccgcgccagctggtggaggagctgcagagc
cgctaccggcagatggaggaacgcatcacctgccccatctgcatcgacagccacatccgc
ctcgtgttccagtgcggccacggcgcatgcgccccctgcggctccgcgctcagcgcctgc
cccatctgccgccagcccatccgcgaccgcatccagatcttcgtgtga

KEGG   Homo sapiens (human): 57534
Entry
57534             CDS       T01001                                 
Symbol
MIB1, DIP-1, DIP1, LVNC7, MIB, ZZANK2, ZZZ6
Name
(RefSeq) MIB E3 ubiquitin protein ligase 1
  KO
K10645  E3 ubiquitin-protein ligase mind-bomb [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05417  Lipid and atherosclerosis
Disease
H01216  Left ventricular noncompaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    57534 (MIB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    57534 (MIB1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     57534 (MIB1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    57534 (MIB1)
SSDB
Motif
Pfam: Ank_2 Ank_5 MIB_HERC2 Ank_4 SH3_15 Ank Ank_3 zf-C3HC4_3 ZZ zf-C3HC4_2 Prok-RING_4
Other DBs
NCBI-GeneID: 57534
NCBI-ProteinID: NP_065825
OMIM: 608677
HGNC: 21086
Ensembl: ENSG00000101752
Pharos: Q86YT6(Tbio)
UniProt: Q86YT6
Structure
LinkDB
Position
18:21704916..21870953
AA seq 1006 aa
MSNSRNNRVMVEGVGARVVRGPDWKWGKQDGGEGHVGTVRSFESPEEVVVVWDNGTAANY
RCSGAYDLRILDSAPTGIKHDGTMCDTCRQQPIIGIRWKCAECTNYDLCTVCYHGDKHHL
RHRFYRITTPGSERVLLESRRKSKKITARGIFAGARVVRGVDWQWEDQDGGNGRRGKVTE
IQDWSASSPHSAAYVLWDNGAKNLYRVGFEGMSDLKCVQDAKGGSFYRDHCPVLGEQNGN
RNPGGLQIGDLVNIDLDLEIVQSLQHGHGGWTDGMFETLTTTGTVCGIDEDHDIVVQYPS
GNRWTFNPAVLTKANIVRSGDAAQGAEGGTSQFQVGDLVQVCYDLERIKLLQRGHGEWAE
AMLPTLGKVGRVQQIYSDSDLKVEVCGTSWTYNPAAVSKVASAGSAISNASGERLSQLLK
KLFETQESGDLNEELVKAAANGDVAKVEDLLKRPDVDVNGQCAGHTAMQAASQNGHVDIL
KLLLKQNVDVEAEDKDGDRAVHHAAFGDEGAVIEVLHRGSADLNARNKRRQTPLHIAVNK
GHLQVVKTLLDFGCHPSLQDSEGDTPLHDAISKKRDDILAVLLEAGADVTITNNNGFNAL
HHAALRGNPSAMRVLLSKLPRPWIVDEKKDDGYTALHLAALNNHVEVAELLVHQGNANLD
IQNVNQQTALHLAVERQHTQIVRLLVRAGAKLDIQDKDGDTPLHEALRHHTLSQLRQLQD
MQDVGKVDAAWEPSKNTLIMGLGTQGAEKKSAASIACFLAANGADLSIRNKKGQSPLDLC
PDPNLCKALAKCHKEKVSGQVGSRSPSMISNDSETLEECMVCSDMKRDTLFGPCGHIATC
SLCSPRVKKCLICKEQVQSRTKIEECVVCSDKKAAVLFQPCGHMCACENCANLMKKCVQC
RAVVERRVPFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQ
TMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY
NT seq 3021 nt   +upstreamnt  +downstreamnt
atgagtaactcccggaataaccgggtgatggtggaaggggttggcgctcgggtagtgcgc
ggcccggactggaagtgggggaagcaggacggcggcgagggccatgtgggcaccgtccgg
agcttcgagagccccgaggaggtggtggtagtgtgggacaacggcacagctgccaactac
cgctgctccggggcttacgacctccgcatcctggacagcgcgcccaccggcatcaagcat
gatggaaccatgtgtgatacctgccgccagcaaccaatcattggcattcgatggaagtgt
gcagagtgtacaaattatgatttgtgcacagtgtgttatcatggagataaacatcattta
agacatcgcttttaccgaattactacaccgggaagtgagagggttctgttagagtctcgt
aggaaatctaagaagattacagccagaggaatctttgcaggtgccagagtggtgcgagga
gtggactggcagtgggaagatcaagatggaggaaatggacgtaggggaaaggtaacagaa
atccaggactggagtgcatcaagcccacatagcgcagcatatgtcctctgggataatggt
gctaagaacctttacagagttggctttgagggcatgtctgatctgaaatgtgtccaggat
gccaagggaggttctttctacagagatcactgccctgtgctaggtgagcagaatggcaac
aggaatcctggtggattgcagattggtgacctggtaaatatagatctcgacctcgaaatt
gtacagtctttgcagcatggtcatggaggatggactgatggaatgtttgagactttaact
acaactggaactgtttgtggcattgatgaagatcatgacattgtagtacagtatccaagt
ggcaataggtggaccttcaatcctgctgttctcactaaagcgaacattgtccgaagtgga
gatgctgctcagggtgcagaaggaggcacctcgcagtttcaagtgggtgatcttgtacaa
gtttgttatgacctggaacgaattaaacttctacaaagaggacatggagaatgggctgaa
gcgatgcttccaactttaggtaaagttggccgagtacaacagatttattcagacagtgat
ttaaaggtggaagtttgtggaacatcttggacatacaatccagcagcagtttccaaggtg
gcatctgcaggatcagccattagcaatgcatctggtgaaagactctcacaactcctgaag
aaattatttgaaacccaagaatctggtgacctcaatgaagaattagttaaggctgctgcc
aatggagatgttgctaaagtggaagatttgcttaaaagaccagatgtggatgtaaatggg
caatgtgctggccacacagctatgcaagctgctagtcagaatggacatgttgacattttg
aagttacttttgaagcaaaacgtggatgtcgaagcagaggataaagatggtgatagagca
gttcaccatgcagcttttggagatgaaggcgctgttatagaagtactacatcgaggtagt
gctgatttgaatgctcgaaacaagcgccgacagacaccacttcatattgctgtcaataaa
ggtcatcttcaagttgtgaagactttattggactttggctgtcatcccagtctccaggat
tctgaaggtgatacccctcttcatgatgcaataagtaagaaacgtgatgatatcctagca
gttcttttggaagctggagcagatgttaccatcacaaacaataatggatttaatgctctg
catcatgctgcactaaggggaaatcccagtgcaatgcgtgttttactatctaaattacca
agaccatggattgtggatgagaagaaagatgatggttatactgccttacatctggctgcc
cttaataatcacgtagaagtggctgaactgttggtacatcagggtaatgcaaacctggat
atccagaatgtgaaccaacaaactgccctacaccttgctgttgaacgacagcatacccag
attgttaggcttttggtccgtgcaggtgccaagcttgatattcaggataaggatggggat
actcctttgcatgaagctctaaggcatcacactttgtctcagctacgtcagctccaagat
atgcaagatgtggggaaggtggatgctgcctgggagccatccaaaaacacgttaataatg
ggacttggtacccagggggcagagaagaagagtgcagcatctattgcctgtttcttggca
gccaatggtgctgacctgagcattcgaaataagaagggtcaatcgccacttgatctctgt
cctgatccgaatctctgcaaagcactggcaaagtgtcataaggaaaaagtcagtggtcaa
gtgggttctcggagtccttctatgattagtaatgattctgaaaccttagaagagtgtatg
gtgtgctcagatatgaagagagatactctttttggtccatgtggacatattgctacctgt
tctttatgttctccacgtgtcaagaaatgcctcatctgtaaagaacaggttcaatccagg
acaaagattgaagaatgtgtggtatgctctgacaagaaagcagctgttctttttcaaccc
tgtggccacatgtgtgcttgtgagaactgtgctaacctgatgaaaaagtgtgtgcagtgt
cgagcagtagttgaacgaagagtgcctttcattatgtgctgtggagggaaaagttcagaa
gatgccactgatgatatctcaagtgggaatattccagtattacaaaaggacaaggataat
accaatgtcaatgcagatgtgcaaaagttgcagcaacagttacaagacattaaagagcag
acaatgtgccctgtgtgtctagatcgtctgaagaatatgattttcctttgtggtcacgga
acctgtcaactctgtggagaccgcatgagtgaatgtcctatctgtcgcaaggctattgaa
cgaaggattcttttgtattaa

DBGET integrated database retrieval system