KEGG   Homo sapiens (human): 1435
Entry
1435              CDS       T01001                                 
Symbol
CSF1, CSF-1, MCSF
Name
(RefSeq) colony stimulating factor 1
  KO
K05453  macrophage colony-stimulating factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04151  PI3K-Akt signaling pathway
hsa04380  Osteoclast differentiation
hsa04640  Hematopoietic cell lineage
hsa04668  TNF signaling pathway
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05323  Rheumatoid arthritis
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01280  IL34/CSF1 to CSF1R signaling
N01281  EBV BARF1 to CSF1R sigaling
Drug target
Linifanib: D09635
Sunitinib (DG00712): D06402<JP/US> D08552
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1435 (CSF1)
   04014 Ras signaling pathway
    1435 (CSF1)
   04015 Rap1 signaling pathway
    1435 (CSF1)
   04668 TNF signaling pathway
    1435 (CSF1)
   04151 PI3K-Akt signaling pathway
    1435 (CSF1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1435 (CSF1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    1435 (CSF1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1435 (CSF1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    1435 (CSF1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    1435 (CSF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1435 (CSF1)
   05022 Pathways of neurodegeneration - multiple diseases
    1435 (CSF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1435 (CSF1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1435 (CSF1)
SSDB
Motif
Pfam: CSF-1
Other DBs
NCBI-GeneID: 1435
NCBI-ProteinID: NP_000748
OMIM: 120420
HGNC: 2432
Ensembl: ENSG00000184371
Pharos: P09603(Tbio)
UniProt: P09603 A0A024R0A1
Structure
LinkDB
Position
1:109910506..109930992
AA seq 554 aa
MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQME
TSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLK
SCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSS
QDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQP
LHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQPRPSVGAFNPGMEDILDSAMG
TNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPLPASAKGQQPA
DVTGTALPRVGPVRPTGQDWNHTPQKTDHPSALLRDPPEPGSPRISSLRPQGLSNPSTLS
AQPQLSRSHSSGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG
HERQSEGSFSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLEQPEG
SPLTQDDRQVELPV
NT seq 1665 nt   +upstreamnt  +downstreamnt
atgaccgcgccgggcgccgccgggcgctgccctcccacgacatggctgggctccctgctg
ttgttggtctgtctcctggcgagcaggagtatcaccgaggaggtgtcggagtactgtagc
cacatgattgggagtggacacctgcagtctctgcagcggctgattgacagtcagatggag
acctcgtgccaaattacatttgagtttgtagaccaggaacagttgaaagatccagtgtgc
taccttaagaaggcatttctcctggtacaagacataatggaggacaccatgcgcttcaga
gataacacccccaatgccatcgccattgtgcagctgcaggaactctctttgaggctgaag
agctgcttcaccaaggattatgaagagcatgacaaggcctgcgtccgaactttctatgag
acacctctccagttgctggagaaggtcaagaatgtctttaatgaaacaaagaatctcctt
gacaaggactggaatattttcagcaagaactgcaacaacagctttgctgaatgctccagc
caagatgtggtgaccaagcctgattgcaactgcctgtaccccaaagccatccctagcagt
gacccggcctctgtctcccctcatcagcccctcgccccctccatggcccctgtggctggc
ttgacctgggaggactctgagggaactgagggcagctccctcttgcctggtgagcagccc
ctgcacacagtggatccaggcagtgccaagcagcggccacccaggagcacctgccagagc
tttgagccgccagagaccccagttgtcaaggacagcaccatcggtggctcaccacagcct
cgcccctctgtcggggccttcaaccccgggatggaggatattcttgactctgcaatgggc
actaattgggtcccagaagaagcctctggagaggccagtgagattcccgtaccccaaggg
acagagctttccccctccaggccaggagggggcagcatgcagacagagcccgccagaccc
agcaacttcctctcagcatcttctccactccctgcatcagcaaagggccaacagccggca
gatgtaactggtaccgccttgcccagggtgggccccgtgaggcccactggccaggactgg
aatcacaccccccagaagacagaccatccatctgccctgctcagagaccccccggagcca
ggctctcccaggatctcatcactgcgcccccagggcctcagcaacccctccaccctctct
gctcagccacagctttccagaagccactcctcgggcagcgtgctgccccttggggagctg
gagggcaggaggagcaccagggatcggaggagccccgcagagccagaaggaggaccagca
agtgaaggggcagccaggcccctgccccgttttaactccgttcctttgactgacacaggc
catgagaggcagtccgagggatccttcagcccgcagctccaggagtctgtcttccacctg
ctggtgcccagtgtcatcctggtcttgctggccgtcggaggcctcttgttctacaggtgg
aggcggcggagccatcaagagcctcagagagcggattctcccttggagcaaccagagggc
agccccctgactcaggatgacagacaggtggaactgccagtgtag

KEGG   Homo sapiens (human): 1942
Entry
1942              CDS       T01001                                 
Symbol
EFNA1, B61, ECKLG, EFL1, EPLG1, GMAN, LERK-1, LERK1, TNFAIP4
Name
(RefSeq) ephrin A1
  KO
K05462  ephrin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1942 (EFNA1)
   04014 Ras signaling pathway
    1942 (EFNA1)
   04015 Rap1 signaling pathway
    1942 (EFNA1)
   04151 PI3K-Akt signaling pathway
    1942 (EFNA1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1942 (EFNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    1942 (EFNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1942 (EFNA1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1942 (EFNA1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    1942 (EFNA1)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1942 (EFNA1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   1942 (EFNA1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  1942 (EFNA1)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 1942
NCBI-ProteinID: NP_004419
OMIM: 191164
HGNC: 3221
Ensembl: ENSG00000169242
Pharos: P20827(Tbio)
UniProt: P20827
Structure
LinkDB
Position
1:155127876..155134899
AA seq 205 aa
MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVA
DAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEF
KEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIG
HSAAPRLFPLAWTVLLLPLLLLQTP
NT seq 618 nt   +upstreamnt  +downstreamnt
atggagttcctctgggcccctctcttgggtctgtgctgcagtctggccgctgctgatcgc
cacaccgtcttctggaacagttcaaatcccaagttccggaatgaggactacaccatacat
gtgcagctgaatgactacgtggacatcatctgtccgcactatgaagatcactctgtggca
gacgctgccatggagcagtacatactgtacctggtggagcatgaggagtaccagctgtgc
cagccccagtccaaggaccaagtccgctggcagtgcaaccggcccagtgccaagcatggc
ccggagaagctgtctgagaagttccagcgcttcacacctttcaccctgggcaaggagttc
aaagaaggacacagctactactacatctccaaacccatccaccagcatgaagaccgctgc
ttgaggttgaaggtgactgtcagtggcaaaatcactcacagtcctcaggcccatgacaat
ccacaggagaagagacttgcagcagatgacccagaggtgcgggttctacatagcatcggt
cacagtgctgccccacgcctcttcccacttgcctggactgtgctgctccttccacttctg
ctgctgcaaaccccgtga

KEGG   Homo sapiens (human): 1943
Entry
1943              CDS       T01001                                 
Symbol
EFNA2, ELF-1, EPLG6, HEK7-L, LERK-6, LERK6
Name
(RefSeq) ephrin A2
  KO
K05462  ephrin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1943 (EFNA2)
   04014 Ras signaling pathway
    1943 (EFNA2)
   04015 Rap1 signaling pathway
    1943 (EFNA2)
   04151 PI3K-Akt signaling pathway
    1943 (EFNA2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1943 (EFNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    1943 (EFNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1943 (EFNA2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1943 (EFNA2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    1943 (EFNA2)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1943 (EFNA2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   1943 (EFNA2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  1943 (EFNA2)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 1943
NCBI-ProteinID: NP_001396
OMIM: 602756
HGNC: 3222
Ensembl: ENSG00000099617
Pharos: O43921(Tbio)
UniProt: O43921
Structure
LinkDB
Position
19:1284227..1301431
AA seq 213 aa
MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYT
VEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAP
GGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEA
PEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS
NT seq 642 nt   +upstreamnt  +downstreamnt
atggcgcccgcgcagcgcccgctgctcccgctgctgctcctgctgttaccgctgccgccg
ccgcccttcgcgcgcgccgaggacgccgcccgcgccaactcggaccgctacgccgtctac
tggaaccgcagcaaccccaggttccacgcaggcgcgggggacgacggcgggggctacacg
gtggaggtgagcatcaatgactacctggacatctactgcccgcactatggggcgccgctg
ccgccggccgagcgcatggagcactacgtgctgtacatggtcaacggcgagggccacgcc
tcctgcgaccaccgccagcgcggcttcaagcgctgggagtgcaaccggcccgcggcgccc
ggggggccgctcaagttctcggagaagttccagctcttcacgcccttctccctgggcttc
gagttccggcccggccacgagtattactacatctctgccacgcctcccaatgctgtggac
cggccctgcctgcgactgaaggtgtacgtgcggccgaccaacgagaccctgtacgaggct
cctgagcccatcttcaccagcaataactcgtgtagcagcccgggcggctgccgcctcttc
ctcagcaccatccccgtgctctggaccctcctgggttcctag

KEGG   Homo sapiens (human): 1944
Entry
1944              CDS       T01001                                 
Symbol
EFNA3, EFL2, EPLG3, Ehk1-L, LERK3
Name
(RefSeq) ephrin A3
  KO
K05462  ephrin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1944 (EFNA3)
   04014 Ras signaling pathway
    1944 (EFNA3)
   04015 Rap1 signaling pathway
    1944 (EFNA3)
   04151 PI3K-Akt signaling pathway
    1944 (EFNA3)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1944 (EFNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    1944 (EFNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1944 (EFNA3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1944 (EFNA3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    1944 (EFNA3)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1944 (EFNA3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   1944 (EFNA3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  1944 (EFNA3)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 1944
NCBI-ProteinID: NP_004943
OMIM: 601381
HGNC: 3223
Ensembl: ENSG00000143590
Pharos: P52797(Tbio)
UniProt: P52797
LinkDB
Position
1:155078837..155087538
AA seq 238 aa
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD
IYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPI
KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPT
LPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcggcggctccgctgctgctgctgctgctgctcgtgcccgtgccgctgctgccgctg
ctggcccaagggcccggaggggcgctgggaaaccggcatgcggtgtactggaacagctcc
aaccagcacctgcggcgagagggctacaccgtgcaggtgaacgtgaacgactatctggat
atttactgcccgcactacaacagctcgggggtgggccccggggcgggaccggggcccgga
ggcggggcagagcagtacgtgctgtacatggtgagccgcaacggctaccgcacctgcaac
gccagccagggcttcaagcgctgggagtgcaaccggccgcacgccccgcacagccccatc
aagttctcggagaagttccagcgctacagcgccttctctctgggctacgagttccacgcc
ggccacgagtactactacatctccacgcccactcacaacctgcactggaagtgtctgagg
atgaaggtgttcgtctgctgcgcctccacatcgcactccggggagaagccggtccccact
ctcccccagttcaccatgggccccaatgtgaagatcaacgtgctggaagactttgaggga
gagaaccctcaggtgcccaagcttgagaagagcatcagcgggaccagccccaaacgggaa
cacctgcccctggccgtgggcatcgccttcttcctcatgacgttcttggcctcctag

KEGG   Homo sapiens (human): 1945
Entry
1945              CDS       T01001                                 
Symbol
EFNA4, EFL4, EPLG4, LERK-4, LERK4
Name
(RefSeq) ephrin A4
  KO
K05462  ephrin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1945 (EFNA4)
   04014 Ras signaling pathway
    1945 (EFNA4)
   04015 Rap1 signaling pathway
    1945 (EFNA4)
   04151 PI3K-Akt signaling pathway
    1945 (EFNA4)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1945 (EFNA4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    1945 (EFNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1945 (EFNA4)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1945 (EFNA4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    1945 (EFNA4)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1945 (EFNA4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   1945 (EFNA4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  1945 (EFNA4)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 1945
NCBI-ProteinID: NP_005218
OMIM: 601380
HGNC: 3224
Ensembl: ENSG00000243364
Pharos: P52798(Tbio)
UniProt: P52798
LinkDB
Position
1:155063740..155069553
AA seq 201 aa
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPH
YEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSL
GFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDT
PSPLCLLLLLLLLILRLLRIL
NT seq 606 nt   +upstreamnt  +downstreamnt
atgcggctgctgcccctgctgcggactgtcctctgggccgcgttcctcggctcccctctg
cgcgggggctccagcctccgccacgtagtctactggaactccagtaaccccaggttgctt
cgaggagacgccgtggtggagctgggcctcaacgattacctagacattgtctgcccccac
tacgaaggcccagggccccctgagggccccgagacgtttgctttgtacatggtggactgg
ccaggctatgagtcctgccaggcagagggcccccgggcctacaagcgctgggtgtgctcc
ctgccctttggccatgttcaattctcagagaagattcagcgcttcacacccttctccctc
ggctttgagttcttacctggagagacttactactacatctcggtgcccactccagagagt
tctggccagtgcttgaggctccaggtgtctgtctgctgcaaggagaggaagtctgagtca
gcccatcctgttgggagccctggagagagtggcacatcagggtggcgagggggggacact
cccagccccctctgtctcttgctattactgctgcttctgattcttcgtcttctgcgaatt
ctgtga

KEGG   Homo sapiens (human): 1946
Entry
1946              CDS       T01001                                 
Symbol
EFNA5, AF1, EFL5, EPLG7, GLC1M, LERK7, RAGS
Name
(RefSeq) ephrin A5
  KO
K05462  ephrin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1946 (EFNA5)
   04014 Ras signaling pathway
    1946 (EFNA5)
   04015 Rap1 signaling pathway
    1946 (EFNA5)
   04151 PI3K-Akt signaling pathway
    1946 (EFNA5)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1946 (EFNA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    1946 (EFNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1946 (EFNA5)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1946 (EFNA5)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    1946 (EFNA5)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1946 (EFNA5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   1946 (EFNA5)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  1946 (EFNA5)
SSDB
Motif
Pfam: Ephrin
Other DBs
NCBI-GeneID: 1946
NCBI-ProteinID: NP_001953
OMIM: 601535
HGNC: 3225
Ensembl: ENSG00000184349
Pharos: P52803(Tbio)
UniProt: P52803
Structure
LinkDB
Position
5:complement(107376894..107670937)
AA seq 228 aa
MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDK
VENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgttgcacgtggagatgttgacgctggtgtttctggtgctctggatgtgtgtgttcagc
caggacccgggctccaaggccgtcgccgaccgctacgctgtctactggaacagcagcaac
cccagattccagaggggtgactaccatattgatgtctgtatcaatgactacctggatgtt
ttctgccctcactatgaggactccgtcccagaagataagactgagcgctatgtcctctac
atggtgaactttgatggctacagtgcctgcgaccacacttccaaagggttcaagagatgg
gaatgtaaccggcctcactctccaaatggaccgctgaagttctctgaaaaattccagctc
ttcactcccttttctctaggatttgaattcaggccaggccgagaatatttctacatctcc
tctgcaatcccagataatggaagaaggtcctgtctaaagctcaaagtctttgtgagacca
acaaatagctgtatgaaaactataggtgttcatgatcgtgttttcgatgttaacgacaaa
gtagaaaattcattagaaccagcagatgacaccgtacatgagtcagccgagccatcccgc
ggcgagaacgcggcacaaacaccaaggatacccagccgccttttggcaatcctactgttc
ctcctggcgatgcttttgacattatag

KEGG   Homo sapiens (human): 1950
Entry
1950              CDS       T01001                                 
Symbol
EGF, HOMG4, URG
Name
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04540  Gap junction
hsa04630  JAK-STAT signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05226  Gastric cancer
hsa05231  Choline metabolism in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06114  PI3K signaling (viruses)
nt06120  Calcium signaling (viruses and bacteria)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06210  ERK signaling
nt06213  Other RAS signaling
nt06214  PI3K signaling
nt06219  JAK-STAT signaling
nt06220  Calcium signaling
nt06227  Nuclear receptor signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
  Element
N00001  EGF-EGFR-RAS-ERK signaling pathway
N00021  EGF-ERBB2-RAS-ERK signaling pathway
N00022  ERBB2-overexpression to RAS-ERK signaling pathway
N00023  EGF-EGFR-PLCG-ERK signaling pathway
N00026  EGF-EGFR-PLCG-CAMK signaling pathway
N00030  EGF-EGFR-RAS-PI3K signaling pathway
N00033  EGF-EGFR-PI3K signaling pathway
N00034  ERBB2-overexpression to PI3K signaling pathway
N00094  EGF-Jak-STAT signaling pathway
N00095  ERBB2-overexpression to EGF-Jak-STAT signaling pathway
N00096  EGF-EGFR-RAS-RASSF1 signaling pathway
N00103  EGF-EGFR-RAS-RalGDS signaling pathway
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00252  Amplified ERBB2 to RAS-ERK signaling pathway
N00253  Amplified ERBB2 to PI3K signaling pathway
N00276  EGF-overexpression to RAS-ERK signaling pathway
N00281  EGF-overexpression to PI3K signaling pathway
N00390  EGF-EGFR-PI3K-NFKB signaling pathway
N00542  EGF-EGFR-RAS-JNK signaling pathway
N01078  EGF-EGFR-Actin signaling pathway
N01364  E2 to nuclear-initiated estrogen signaling pathway
Disease
H00020  Colorectal cancer
H01210  Hypomagnesemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1950 (EGF)
   04012 ErbB signaling pathway
    1950 (EGF)
   04014 Ras signaling pathway
    1950 (EGF)
   04015 Rap1 signaling pathway
    1950 (EGF)
   04630 JAK-STAT signaling pathway
    1950 (EGF)
   04066 HIF-1 signaling pathway
    1950 (EGF)
   04068 FoxO signaling pathway
    1950 (EGF)
   04020 Calcium signaling pathway
    1950 (EGF)
   04072 Phospholipase D signaling pathway
    1950 (EGF)
   04151 PI3K-Akt signaling pathway
    1950 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    1950 (EGF)
   04540 Gap junction
    1950 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    1950 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1950 (EGF)
   05207 Chemical carcinogenesis - receptor activation
    1950 (EGF)
   05208 Chemical carcinogenesis - reactive oxygen species
    1950 (EGF)
   05231 Choline metabolism in cancer
    1950 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    1950 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    1950 (EGF)
   05212 Pancreatic cancer
    1950 (EGF)
   05226 Gastric cancer
    1950 (EGF)
   05214 Glioma
    1950 (EGF)
   05218 Melanoma
    1950 (EGF)
   05219 Bladder cancer
    1950 (EGF)
   05215 Prostate cancer
    1950 (EGF)
   05213 Endometrial cancer
    1950 (EGF)
   05224 Breast cancer
    1950 (EGF)
   05223 Non-small cell lung cancer
    1950 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    1950 (EGF)
   05165 Human papillomavirus infection
    1950 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    1950 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1950 (EGF)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1950 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF EGF_CA cEGF EGF_3 DUF5050
Other DBs
NCBI-GeneID: 1950
NCBI-ProteinID: NP_001954
OMIM: 131530
HGNC: 3229
Ensembl: ENSG00000138798
Pharos: P01133(Tbio)
UniProt: P01133
Structure
LinkDB
Position
4:109912883..110013766
AA seq 1207 aa
MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRID
TEGTNYEQLVVDAGVSVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHILLSALKYPANVAVDPVERFIFWSSEVAG
SLYRADLDGVGVKALLETSEKITAVSLDVLDKRLFWIQYNREGSNSLICSCDYDGGSVHI
SKHPTQHNLFAMSLFGDRIFYSTWKMKTIWIANKHTGKDMVRINLHSSFVPLGELKVVHP
LAQPKAEDDTWEPEQKLCKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNEC
AFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPL
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCVPLSPVSWECDCFPGYDLQLDEKSCAASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIITKENISQP
RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVR
LQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKKRLGTAWCSCREGFMKASDGKTC
LALDGHQLLAGGEVDLKNQVTPLDILSKTRVSEDNITESQHMLVAEIMVSDQDDCAPVGC
SMYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCS
EGYQGDGIHCLDIDECQLGEHSCGENASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHL
REDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW
ELRHAGHGQQQKVIVVAVCVVVLVMLLLLSLWGAHYYRTQKLLSKNPKNPYEESSRDVRS
RRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQAADGSMQPTSWRQEPQLCGM
GTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEKPHSLLSANPLWQQRALDPP
HQMELTQ
NT seq 3624 nt   +upstreamnt  +downstreamnt
atgctgctcactcttatcattctgttgccagtagtttcaaaatttagttttgttagtctc
tcagcaccgcagcactggagctgtcctgaaggtactctcgcaggaaatgggaattctact
tgtgtgggtcctgcacccttcttaattttctcccatggaaatagtatctttaggattgac
acagaaggaaccaattatgagcaattggtggtggatgctggtgtctcagtgatcatggat
tttcattataatgagaaaagaatctattgggtggatttagaaagacaacttttgcaaaga
gtttttctgaatgggtcaaggcaagagagagtatgtaatatagagaaaaatgtttctgga
atggcaataaattggataaatgaagaagttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggaaataattcccacattcttttaagtgctttaaaatatcct
gcaaatgtagcagttgatccagtagaaaggtttatattttggtcttcagaggtggctgga
agcctttatagagcagatctcgatggtgtgggagtgaaggctctgttggagacatcagag
aaaataacagctgtgtcattggatgtgcttgataagcggctgttttggattcagtacaac
agagaaggaagcaattctcttatttgctcctgtgattatgatggaggttctgtccacatt
agtaaacatccaacacagcataatttgtttgcaatgtccctttttggtgaccgtatcttc
tattcaacatggaaaatgaagacaatttggatagccaacaaacacactggaaaggacatg
gttagaattaacctccattcatcatttgtaccacttggtgaactgaaagtagtgcatcca
cttgcacaacccaaggcagaagatgacacttgggagcctgagcagaaactttgcaaattg
aggaaaggaaactgcagcagcactgtgtgtgggcaagacctccagtcacacttgtgcatg
tgtgcagagggatacgccctaagtcgagaccggaagtactgtgaagatgttaatgaatgt
gctttttggaatcatggctgtactcttgggtgtaaaaacacccctggatcctattactgc
acgtgccctgtaggatttgttctgcttcctgatgggaaacgatgtcatcaacttgtttcc
tgtccacgcaatgtgtctgaatgcagccatgactgtgttctgacatcagaaggtccctta
tgtttctgtcctgaaggctcagtgcttgagagagatgggaaaacatgtagcggttgttcc
tcacccgataatggtggatgtagccagctctgcgttcctcttagcccagtatcctgggaa
tgtgattgctttcctgggtatgacctacaactggatgaaaaaagctgtgcagcttcagga
ccacaaccatttttgctgtttgccaattctcaagatattcgacacatgcattttgatgga
acagactatggaactctgctcagccagcagatgggaatggtttatgccctagatcatgac
cctgtggaaaataagatatactttgcccatacagccctgaagtggatagagagagctaat
atggatggttcccagcgagaaaggcttattgaggaaggagtagatgtgccagaaggtctt
gctgtggactggattggccgtagattctattggacagacagagggaaatctctgattgga
aggagtgatttaaatgggaaacgttccaaaataatcactaaggagaacatctctcaacca
cgaggaattgctgttcatccaatggccaagagattattctggactgatacagggattaat
ccacgaattgaaagttcttccctccaaggccttggccgtctggttatagccagctctgat
ctaatctggcccagtggaataacgattgacttcttaactgacaagttgtactggtgcgat
gccaagcagtctgtgattgaaatggccaatctggatggttcaaaacgccgaagacttacc
cagaatgatgtaggtcacccatttgctgtagcagtgtttgaggattatgtgtggttctca
gattgggctatgccatcagtaatgagagtaaacaagaggactggcaaagatagagtacgt
ctccaaggcagcatgctgaagccctcatcactggttgtggttcatccattggcaaaacca
ggagcagatccctgcttatatcaaaacggaggctgtgaacatatttgcaaaaagaggctt
ggaactgcttggtgttcgtgtcgtgaaggttttatgaaagcctcagatgggaaaacgtgt
ctggctctggatggtcatcagctgttggcaggtggtgaagttgatctaaagaaccaagta
acaccattggacatcttgtccaagactagagtgtcagaagataacattacagaatctcaa
cacatgctagtggctgaaatcatggtgtcagatcaagatgactgtgctcctgtgggatgc
agcatgtatgctcggtgtatttcagagggagaggatgccacatgtcagtgtttgaaagga
tttgctggggatggaaaactatgttctgatatagatgaatgtgagatgggtgtcccagtg
tgcccccctgcctcctccaagtgcatcaacaccgaaggtggttatgtctgccggtgctca
gaaggctaccaaggagatgggattcactgtcttgatattgatgagtgccaactgggggag
cacagctgtggagagaatgccagctgcacaaatacagagggaggctatacctgcatgtgt
gctggacgcctgtctgaaccaggactgatttgccctgactctactccaccccctcacctc
agggaagatgaccaccactattccgtaagaaatagtgactctgaatgtcccctgtcccac
gatgggtactgcctccatgatggtgtgtgcatgtatattgaagcattggacaagtatgca
tgcaactgtgttgttggctacatcggggagcgatgtcagtaccgagacctgaagtggtgg
gaactgcgccacgctggccacgggcagcagcagaaggtcatcgtggtggctgtctgcgtg
gtggtgcttgtcatgctgctcctcctgagcctgtggggggcccactactacaggactcag
aagctgctatcgaaaaacccaaagaatccttatgaggagtcgagcagagatgtgaggagt
cgcaggcctgctgacactgaggatgggatgtcctcttgccctcaaccttggtttgtggtt
ataaaagaacaccaagacctcaagaatgggggtcaaccagtggctggtgaggatggccag
gcagcagatgggtcaatgcaaccaacttcatggaggcaggagccccagttatgtggaatg
ggcacagagcaaggctgctggattccagtatccagtgataagggctcctgtccccaggta
atggagcgaagctttcatatgccctcctatgggacacagacccttgaagggggtgtcgag
aagccccattctctcctatcagctaacccattatggcaacaaagggccctggacccacca
caccaaatggagctgactcagtga

KEGG   Homo sapiens (human): 2069
Entry
2069              CDS       T01001                                 
Symbol
EREG, EPR, ER, Ep
Name
(RefSeq) epiregulin
  KO
K09784  epiregulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa05210  Colorectal cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06260  Colorectal cancer
  Element
N00277  EREG-EGFR-RAS-ERK signaling pathway
N00278  EREG-overexpression to RAS-ERK signaling pathway
N00282  EREG-EGFR-PI3K signaling pathway
N00283  EREG-overexpression to PI3K signaling pathway
Disease
H00020  Colorectal cancer
Drug target
Fepixnebart: D12343
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2069 (EREG)
   04012 ErbB signaling pathway
    2069 (EREG)
   04151 PI3K-Akt signaling pathway
    2069 (EREG)
 09160 Human Diseases
  09162 Cancer: specific types
   05210 Colorectal cancer
    2069 (EREG)
SSDB
Motif
Pfam: EGF BCCT CD34_antigen Sigma_reg_N DUF6568
Other DBs
NCBI-GeneID: 2069
NCBI-ProteinID: NP_001423
OMIM: 602061
HGNC: 3443
Ensembl: ENSG00000124882
Pharos: O14944(Tbio)
UniProt: O14944
Structure
LinkDB
Position
4:74365145..74388749
AA seq 169 aa
MTAGRRMEMLCAGRVPALLLCLGFHLLQAVLSTTVIPSCIPGESSDNCTALVQTEDNPRV
AQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVA
LTVILIILFLITVVGSTYYFCRWYRNRKSKEPKKEYERVTSGDPELPQV
NT seq 510 nt   +upstreamnt  +downstreamnt
atgaccgcggggaggaggatggagatgctctgtgccggcagggtccctgcgctgctgctc
tgcctgggtttccatcttctacaggcagtcctcagtacaactgtgattccatcatgtatc
ccaggagagtccagtgataactgcacagctttagttcagacagaagacaatccacgtgtg
gctcaagtgtcaataacaaagtgtagctctgacatgaatggctattgtttgcatggacag
tgcatctatctggtggacatgagtcaaaactactgcaggtgtgaagtgggttatactggt
gtccgatgtgaacacttctttttaaccgtccaccaacctttaagcaaagaatatgtggct
ttgaccgtgattcttattattttgtttcttatcacagtcgtcggttccacatattatttc
tgcagatggtacagaaatcgaaaaagtaaagaaccaaagaaggaatatgagagagttacc
tcaggggatccagagttgccgcaagtctga

KEGG   Homo sapiens (human): 2246
Entry
2246              CDS       T01001                                 
Symbol
FGF1, AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-1, FGF-alpha, FGFA, GLIO703, HBGF-1, HBGF1
Name
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06261  Gastric cancer
nt06265  Bladder cancer
nt06270  Breast cancer
nt06361  Hypogonadotropic hypogonadism
  Element
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2246 (FGF1)
   04014 Ras signaling pathway
    2246 (FGF1)
   04015 Rap1 signaling pathway
    2246 (FGF1)
   04390 Hippo signaling pathway
    2246 (FGF1)
   04020 Calcium signaling pathway
    2246 (FGF1)
   04151 PI3K-Akt signaling pathway
    2246 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2246 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2246 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    2246 (FGF1)
   05218 Melanoma
    2246 (FGF1)
   05224 Breast cancer
    2246 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2246 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2246 (FGF1)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2246 (FGF1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   2246 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 2246
NCBI-ProteinID: NP_000791
OMIM: 131220
HGNC: 3665
Ensembl: ENSG00000113578
Pharos: P05230(Tchem)
UniProt: P05230 A0A7U3JVZ2
Structure
LinkDB
Position
5:complement(142592178..142698070)
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcaccaccttcacagccctgaccgagaagtttaatctgcctcca
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccggatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttc
ctggaaaggctggaggagaaccattacaacacctatatatccaagaagcatgcagagaag
aattggtttgttggcctcaagaagaatgggagctgcaaacgcggtcctcggactcactat
ggccagaaagcaatcttgtttctccccctgccagtctcttctgattaa

KEGG   Homo sapiens (human): 2247
Entry
2247              CDS       T01001                                 
Symbol
FGF2, BFGF, FGF-2, FGFB, HBGF-2
Name
(RefSeq) fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04810  Regulation of actin cytoskeleton
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06261  Gastric cancer
nt06265  Bladder cancer
nt06270  Breast cancer
nt06361  Hypogonadotropic hypogonadism
  Element
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2247 (FGF2)
   04014 Ras signaling pathway
    2247 (FGF2)
   04015 Rap1 signaling pathway
    2247 (FGF2)
   04020 Calcium signaling pathway
    2247 (FGF2)
   04151 PI3K-Akt signaling pathway
    2247 (FGF2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    2247 (FGF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2247 (FGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2247 (FGF2)
   05205 Proteoglycans in cancer
    2247 (FGF2)
   05207 Chemical carcinogenesis - receptor activation
    2247 (FGF2)
  09162 Cancer: specific types
   05226 Gastric cancer
    2247 (FGF2)
   05218 Melanoma
    2247 (FGF2)
   05224 Breast cancer
    2247 (FGF2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    2247 (FGF2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    2247 (FGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2247 (FGF2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2247 (FGF2)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2247 (FGF2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   2247 (FGF2)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 2247
NCBI-ProteinID: NP_001997
OMIM: 134920
HGNC: 3676
Ensembl: ENSG00000138685
Pharos: P09038(Tchem)
UniProt: P09038
Structure
LinkDB
Position
4:122826682..122898236
AA seq 288 aa
MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NT seq 867 nt   +upstreamnt  +downstreamnt
ctggtgggtgtggggggtggagatgtagaagatgtgacgccgcggcccggcgggtgccag
attagcggacgcggtgcccgcggttgcaacgggatcccgggcgctgcagcttgggaggcg
gctctccccaggcggcgtccgcggagacacccatccgtgaaccccaggtcccgggccgcc
ggctcgccgcgcaccaggggccggcggacagaagagcggccgagcggctcgaggctgggg
gaccgcgggcgcggccgcgcgctgccgggcgggaggctggggggccggggccggggccgt
gccccggagcgggtcggaggccggggccggggccgggggacggcggctccccgcgcggct
ccagcggctcggggatcccggccgggccccgcagggaccatggcagccgggagcatcacc
acgctgcccgccttgcccgaggatggcggcagcggcgccttcccgcccggccacttcaag
gaccccaagcggctgtactgcaaaaacgggggcttcttcctgcgcatccaccccgacggc
cgagttgacggggtccgggagaagagcgaccctcacatcaagctacaacttcaagcagaa
gagagaggagttgtgtctatcaaaggagtgtgtgctaaccgttacctggctatgaaggaa
gatggaagattactggcttctaaatgtgttacggatgagtgtttcttttttgaacgattg
gaatctaataactacaatacttaccggtcaaggaaatacaccagttggtatgtggcactg
aaacgaactgggcagtataaacttggatccaaaacaggacctgggcagaaagctatactt
tttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system