KEGG   Homo sapiens (human): 1440
Entry
1440              CDS       T01001                                 
Symbol
CSF3, C17orf33, CSF3OS, GCSF, G-CSF
Name
(RefSeq) colony stimulating factor 3
  KO
K05423  granulocyte colony-stimulating factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04657  IL-17 signaling pathway
hsa05144  Malaria
hsa05171  Coronavirus disease - COVID-19
Network
nt06518  JAK-STAT signaling
  Element
N01555  Hormone-like-cytokine to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1440 (CSF3)
   04151 PI3K-Akt signaling pathway
    1440 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1440 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1440 (CSF3)
   04657 IL-17 signaling pathway
    1440 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    1440 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    1440 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    1440 (CSF3)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  CSF and other factors
   1440 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 NAGLU Img2
Other DBs
NCBI-GeneID: 1440
NCBI-ProteinID: NP_000750
OMIM: 138970
HGNC: 2438
Ensembl: ENSG00000108342
UniProt: P09919 Q8N4W3
Structure
LinkDB
Position
17:40015440..40017813
AA seq 207 aa
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA
LQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQG
LLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRR
AGGVLVASHLQSFLEVSYRVLRHLAQP
NT seq 624 nt   +upstreamnt  +downstreamnt
atggctggacctgccacccagagccccatgaagctgatggccctgcagctgctgctgtgg
cacagtgcactctggacagtgcaggaagccacccccctgggccctgccagctccctgccc
cagagcttcctgctcaagtgcttagagcaagtgaggaagatccagggcgatggcgcagcg
ctccaggagaagctggtgagtgagtgtgccacctacaagctgtgccaccccgaggagctg
gtgctgctcggacactctctgggcatcccctgggctcccctgagcagctgccccagccag
gccctgcagctggcaggctgcttgagccaactccatagcggccttttcctctaccagggg
ctcctgcaggccctggaagggatctcccccgagttgggtcccaccttggacacactgcag
ctggacgtcgccgactttgccaccaccatctggcagcagatggaagaactgggaatggcc
cctgccctgcagcccacccagggtgccatgccggccttcgcctctgctttccagcgccgg
gcaggaggggtcctggttgcctcccatctgcagagcttcctggaggtgtcgtaccgcgtt
ctacgccaccttgcccagccctga

KEGG   Homo sapiens (human): 1442
Entry
1442              CDS       T01001                                 
Symbol
CSH1, CS-1, CSA, CSMT, GHB3, PL, hCS-1, hCS-A
Name
(RefSeq) chorionic somatomammotropin hormone 1
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1442 (CSH1)
   04151 PI3K-Akt signaling pathway
    1442 (CSH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1442 (CSH1)
   04060 Cytokine-cytokine receptor interaction
    1442 (CSH1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    1442 (CSH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    1442 (CSH1)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  CSF and other factors
   1442 (CSH1)
SSDB
Motif
Pfam: Hormone_1 SrpI-like
Other DBs
NCBI-GeneID: 1442
NCBI-ProteinID: NP_001308
OMIM: 150200
HGNC: 2440
Ensembl: ENSG00000136488
CPD: C18210
UniProt: P0DML2 P0DML3 A8K6C2
Structure
LinkDB
Position
17:complement(63894918..63896574)
AA seq 217 aa
MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctccaggctcccggacgtccctgctcctggcttttgccctgctctgcctgccctgg
cttcaagaggctggtgccgtccaaaccgttcccttatccaggctttttgaccacgctatg
ctccaagcccatcgcgcgcaccagctggccattgacacctaccaggagtttgaagaaacc
tatatcccaaaggaccagaagtattcattcctgcatgactcccagacctccttctgcttc
tcagactctattccgacaccctccaacatggaggaaacgcaacagaaatccaatctagag
ctgctccgcatctccctgctgctcatcgagtcgtggctggagcccgtgcggttcctcagg
agtatgttcgccaacaacctggtgtatgacacctcggacagcgatgactatcacctccta
aaggacctagaggaaggcatccaaacgctgatggggaggctggaagacggcagccgccgg
actgggcagatcctcaagcagacctacagcaagtttgacacaaactcgcacaaccatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatggtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Homo sapiens (human): 1443
Entry
1443              CDS       T01001                                 
Symbol
CSH2, CS-2, CSB, GHB1, PL, hCS-B
Name
(RefSeq) chorionic somatomammotropin hormone 2
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1443 (CSH2)
   04151 PI3K-Akt signaling pathway
    1443 (CSH2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1443 (CSH2)
   04060 Cytokine-cytokine receptor interaction
    1443 (CSH2)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    1443 (CSH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    1443 (CSH2)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  CSF and other factors
   1443 (CSH2)
SSDB
Motif
Pfam: Hormone_1 SrpI-like
Other DBs
NCBI-GeneID: 1443
NCBI-ProteinID: NP_066271
OMIM: 118820
HGNC: 2441
Ensembl: ENSG00000213218
UniProt: P0DML3 A0A0M6L0F6
LinkDB
Position
17:complement(63872012..63873729)
AA seq 217 aa
MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacgtccctgctcctggcttttgccctgctctgcctgccctgg
cttcaagaggctggtgccgtccaaaccgttccgttatccaggctttttgaccacgctatg
ctccaagcccatcgcgcgcaccagctggccattgacacctaccaggagtttgaagaaacc
tatatcccaaaggaccagaagtattcattcctgcatgactcccagacctccttctgcttc
tcagactctattccgacaccctccaacatggaggaaacgcaacagaaatccaatctagag
ctgctccgcatctccctgctgctcatcgagtcgtggctggagcccgtgcggttcctcagg
agtatgttcgccaacaacctggtgtatgacacctcggacagcgatgactatcacctccta
aaggacctagaggaaggcatccaaacgctgatggggaggctggaagacggcagccgccgg
actgggcagatcctcaagcagacctacagcaagtttgacacaaactcacacaaccatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatggtgcagtgccgctctgtagagggtagctgtggcttctag

KEGG   Homo sapiens (human): 1444
Entry
1444              CDS       T01001                                 
Symbol
CSHL1, CS-5, CSHP1, CSL, GHB4, hCS-L
Name
(RefSeq) chorionic somatomammotropin hormone like 1
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1444 (CSHL1)
   04151 PI3K-Akt signaling pathway
    1444 (CSHL1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1444 (CSHL1)
   04060 Cytokine-cytokine receptor interaction
    1444 (CSHL1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    1444 (CSHL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    1444 (CSHL1)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  CSF and other factors
   1444 (CSHL1)
SSDB
Motif
Pfam: Hormone_1 IL2
Other DBs
NCBI-GeneID: 1444
NCBI-ProteinID: NP_072101
OMIM: 603515
HGNC: 2442
Ensembl: ENSG00000204414
UniProt: Q14406 I6L999
LinkDB
Position
17:complement(63909608..63911258)
AA seq 222 aa
MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFKEAMLQAHRAHQLAIDTYQEFISS
WGMEAYITKEQKYSFLHDSQTSFCFSDSIPTSSNMEETQQKSNLELLHISLLLIESRLEP
VRFLRSTFTNNLVYDTSDSDDYHLLKDLEEGIQMLMGRLEDGSHLTGQTLKQTYSKFDTN
SHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSVEGSCGF
NT seq 669 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacgtccctgctcctggcttttgccctgctctgcctgccctgg
cttcaagaggctggtgccgtccaaaccgttcccttatccaggctttttaaagaggctatg
ctccaagcccatcgcgcacaccagctggccattgacacctaccaggagtttataagctct
tggggaatggaagcctatatcacaaaggaacagaagtattcattcctgcatgactcccag
acctccttctgcttctcagactctattccgacatcctccaacatggaggaaacgcagcag
aaatccaacttagagctgctccacatctccctgctgctcatcgagtcgcggctggagccc
gtgcggttcctcaggagtaccttcaccaacaacctggtgtatgacacctcggacagcgat
gactatcacctcctaaaggacctagaggaaggcatccaaatgctgatggggaggctggaa
gacggcagccacctgactgggcagaccctcaagcagacctacagcaagtttgacacaaac
tcgcacaaccatgacgcactgctcaagaactacgggctgctccactgcttcaggaaggac
atggacaaggtcgagacattcctgcgcatggtgcagtgccgctctgtggagggcagctgt
ggcttctag

KEGG   Homo sapiens (human): 2056
Entry
2056              CDS       T01001                                 
Symbol
EPO, DBAL, ECYT5, EP, MVCD2
Name
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04066  HIF-1 signaling pathway
hsa04148  Efferocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06518  JAK-STAT signaling
nt06535  Efferocytosis
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N01555  Hormone-like-cytokine to Jak-STAT signaling pathway
N01750  Find-me signal (S1P)
N01751  Macrophage EPO signaling
Disease
H00236  Congenital polycythemia
H01457  Diabetic retinopathy
H02559  Microvascular complications of diabetes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    2056 (EPO)
   04066 HIF-1 signaling pathway
    2056 (EPO)
   04151 PI3K-Akt signaling pathway
    2056 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2056 (EPO)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    2056 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2056 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2056 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    2056 (EPO)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  CSF and other factors
   2056 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 2056
NCBI-ProteinID: NP_000790
OMIM: 133170
HGNC: 3415
Ensembl: ENSG00000130427
CPD: C18200
UniProt: P01588 G9JKG7
Structure
LinkDB
Position
7:100720468..100723700
AA seq 193 aa
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHC
SLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL
HVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKL
KLYTGEACRTGDR
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggggtgcacgaatgtcctgcctggctgtggcttctcctgtccctgctgtcgctccct
ctgggcctcccagtcctgggcgccccaccacgcctcatctgtgacagccgagtcctggag
aggtacctcttggaggccaaggaggccgagaatatcacgacgggctgtgctgaacactgc
agcttgaatgagaatatcactgtcccagacaccaaagttaatttctatgcctggaagagg
atggaggtcgggcagcaggccgtagaagtctggcagggcctggccctgctgtcggaagct
gtcctgcggggccaggccctgttggtcaactcttcccagccgtgggagcccctgcagctg
catgtggataaagccgtcagtggccttcgcagcctcaccactctgcttcgggctctggga
gcccagaaggaagccatctcccctccagatgcggcctcagctgctccactccgaacaatc
actgctgacactttccgcaaactcttccgagtctactccaatttcctccggggaaagctg
aagctgtacacaggggaggcctgcaggacaggggacagatga

KEGG   Homo sapiens (human): 2688
Entry
2688              CDS       T01001                                 
Symbol
GH1, GH, GH-N, GHB5, GHN, IGHD1A, IGHD1B, IGHD2, hGH-N
Name
(RefSeq) growth hormone 1
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Network
nt06324  GHRH-GH-IGF signaling
nt06518  JAK-STAT signaling
  Element
N00907  GH-Jak-STAT signaling pathway
N00910  GHRHR-PKA-GH signaling pathway
N01555  Hormone-like-cytokine to Jak-STAT signaling pathway
Disease
H00254  Growth hormone deficiency
H02035  Isolated growth hormone deficiency
H02039  Kowarski syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    2688 (GH1)
   04151 PI3K-Akt signaling pathway
    2688 (GH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2688 (GH1)
   04060 Cytokine-cytokine receptor interaction
    2688 (GH1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    2688 (GH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    2688 (GH1)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  CSF and other factors
   2688 (GH1)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 2688
NCBI-ProteinID: NP_000506
OMIM: 139250
HGNC: 4261
Ensembl: ENSG00000259384
CPD: C18181
UniProt: P01241 B1A4G6
Structure
LinkDB
Position
17:complement(63917203..63918839)
AA seq 217 aa
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctacaggctcccggacgtccctgctcctggcttttggcctgctctgcctgccctgg
cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaacgctatg
ctccgcgcccatcgtctgcaccagctggcctttgacacctaccaggagtttgaagaagcc
tatatcccaaaggaacagaagtattcattcctgcagaacccccagacctccctctgtttc
tcagagtctattccgacaccctccaacagggaggaaacacaacagaaatccaacctagag
ctgctccgcatctccctgctgctcatccagtcgtggctggagcccgtgcagttcctcagg
agtgtcttcgccaacagcctggtgtacggcgcctctgacagcaacgtctatgacctccta
aaggacctagaggaaggcatccaaacgctgatggggaggctggaagatggcagcccccgg
actgggcagatcttcaagcagacctacagcaagttcgacacaaactcacacaacgatgac
gcactactcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatcgtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Homo sapiens (human): 2689
Entry
2689              CDS       T01001                                 
Symbol
GH2, GH-V, GHB2, GHL, GHV, hGH-V
Name
(RefSeq) growth hormone 2
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Network
nt06324  GHRH-GH-IGF signaling
nt06518  JAK-STAT signaling
  Element
N00907  GH-Jak-STAT signaling pathway
N00910  GHRHR-PKA-GH signaling pathway
N01555  Hormone-like-cytokine to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    2689 (GH2)
   04151 PI3K-Akt signaling pathway
    2689 (GH2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2689 (GH2)
   04060 Cytokine-cytokine receptor interaction
    2689 (GH2)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    2689 (GH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    2689 (GH2)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  CSF and other factors
   2689 (GH2)
SSDB
Motif
Pfam: Hormone_1 DUF594
Other DBs
NCBI-GeneID: 2689
NCBI-ProteinID: NP_002050
OMIM: 139240
HGNC: 4262
Ensembl: ENSG00000136487
UniProt: P01242 A0A0M6L0J9
LinkDB
Position
17:complement(63880215..63881944)
AA seq 217 aa
MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEA
YILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLR
SVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacgtccctgctcctggcttttggcctgctctgcctgtcctgg
cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaacgctatg
ctccgcgcccgtcgcctgtaccagctggcatatgacacctatcaggagtttgaagaagcc
tatatcctgaaggagcagaagtattcattcctgcagaacccccagacctccctctgcttc
tcagagtctattccaacaccttccaacagggtgaaaacgcagcagaaatctaacctagag
ctgctccgcatctccctgctgctcatccagtcatggctggagcccgtgcagctcctcagg
agcgtcttcgccaacagcctggtgtatggcgcctcggacagcaacgtctatcgccacctg
aaggacctagaggaaggcatccaaacgctgatgtggaggctggaagatggcagcccccgg
actgggcagatcttcaatcagtcctacagcaagtttgacacaaaatcgcacaacgatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatcgtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Homo sapiens (human): 3952
Entry
3952              CDS       T01001                                 
Symbol
LEP, LEPD, OB, OBS
Name
(RefSeq) leptin
  KO
K05424  leptin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04152  AMPK signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04932  Non-alcoholic fatty liver disease
Network
nt06325  Hormone/cytokine signaling
nt06518  JAK-STAT signaling
  Element
N01555  Hormone-like-cytokine to Jak-STAT signaling pathway
N01800  LEP-LEPR signaling pathway
Disease
H02059  Leptin deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3952 (LEP)
   04152 AMPK signaling pathway
    3952 (LEP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3952 (LEP)
   04060 Cytokine-cytokine receptor interaction
    3952 (LEP)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    3952 (LEP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    3952 (LEP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    3952 (LEP)
Cytokines and neuropeptides [BR:hsa04052]
 Neuropeptides
  Neuropeptides (Unclassified)
   3952 (LEP)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 3952
NCBI-ProteinID: NP_000221
OMIM: 164160
HGNC: 6553
Ensembl: ENSG00000174697
CPD: C18188
UniProt: P41159 A4D0Y8
Structure
LinkDB
Position
7:128241278..128257629
AA seq 167 aa
MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGL
DFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP
WASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcattggggaaccctgtgcggattcttgtggctttggccctatcttttctatgtccaa
gctgtgcccatccaaaaagtccaagatgacaccaaaaccctcatcaagacaattgtcacc
aggatcaatgacatttcacacacgcagtcagtctcctccaaacagaaagtcaccggtttg
gacttcattcctgggctccaccccatcctgaccttatccaagatggaccagacactggca
gtctaccaacagatcctcaccagtatgccttccagaaacgtgatccaaatatccaacgac
ctggagaacctccgggatcttcttcacgtgctggccttctctaagagctgccacttgccc
tgggccagtggcctggagaccttggacagcctggggggtgtcctggaagcttcaggctac
tccacagaggtggtggccctgagcaggctgcaggggtctctgcaggacatgctgtggcag
ctggacctcagccctgggtgctga

KEGG   Homo sapiens (human): 5617
Entry
5617              CDS       T01001                                 
Symbol
PRL, GHA1
Name
(RefSeq) prolactin
  KO
K05439  prolactin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04917  Prolactin signaling pathway
Network
nt06325  Hormone/cytokine signaling
nt06518  JAK-STAT signaling
  Element
N00920  PRL-JAK-STAT signaling pathway
N01555  Hormone-like-cytokine to Jak-STAT signaling pathway
Drug target
Bromocriptine (DG00452): D00780<JP/US> D03165
Cabergoline: D00987<JP/US>
Terguride: D01348
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    5617 (PRL)
   04151 PI3K-Akt signaling pathway
    5617 (PRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5617 (PRL)
   04060 Cytokine-cytokine receptor interaction
    5617 (PRL)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    5617 (PRL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    5617 (PRL)
Cytokines and neuropeptides [BR:hsa04052]
 Neuropeptides
  Neuropeptides (Unclassified)
   5617 (PRL)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 5617
NCBI-ProteinID: NP_000939
OMIM: 176760
HGNC: 9445
Ensembl: ENSG00000172179
CPD: C18201
UniProt: P01236 Q5THQ0
Structure
LinkDB
Position
6:complement(22287246..22302835)
AA seq 227 aa
MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNL
SSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWN
EPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSG
LPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaacatcaaaggatcgccatggaaagggtccctcctgctgctgctggtgtcaaacctg
ctcctgtgccagagcgtggcccccttgcccatctgtcccggcggggctgcccgatgccag
gtgacccttcgagacctgtttgaccgcgccgtcgtcctgtcccactacatccataacctc
tcctcagaaatgttcagcgaattcgataaacggtatacccatggccgggggttcattacc
aaggccatcaacagctgccacacttcttcccttgccacccccgaagacaaggagcaagcc
caacagatgaatcaaaaagactttctgagcctgatagtcagcatattgcgatcctggaat
gagcctctgtatcatctggtcacggaagtacgtggtatgcaagaagccccggaggctatc
ctatccaaagctgtagagattgaggagcaaaccaaacggcttctagagggcatggagctg
atagtcagccaggttcatcctgaaaccaaagaaaatgagatctaccctgtctggtcggga
cttccatccctgcagatggctgatgaagagtctcgcctttctgcttattataacctgctc
cactgcctacgcagggattcacataaaatcgacaattatctcaagctcctgaagtgccga
atcatccacaacaacaactgctaa

KEGG   Homo sapiens (human): 7066
Entry
7066              CDS       T01001                                 
Symbol
THPO, CAMT2, MGDF, MKCSF, ML, MPLLG, THC9, THCYT1, TPO
Name
(RefSeq) thrombopoietin
  KO
K06854  thrombopoietin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
Network
nt06518  JAK-STAT signaling
  Element
N01555  Hormone-like-cytokine to Jak-STAT signaling pathway
Disease
H00227  Congenital amegakaryocytic thrombocytopenia
H00978  Thrombocytopenia (THC)
H01612  Essential thrombocythemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    7066 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7066 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    7066 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    7066 (THPO)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  CSF and other factors
   7066 (THPO)
SSDB
Motif
Pfam: EPO_TPO CYTL1
Other DBs
NCBI-GeneID: 7066
NCBI-ProteinID: NP_000451
OMIM: 600044
HGNC: 11795
Ensembl: ENSG00000090534
UniProt: P40225
Structure
LinkDB
Position
3:complement(184371935..184379688)
AA seq 353 aa
MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPV
LLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRL
LLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTT
AVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSL
DQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPP
TGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggagctgactgaattgctcctcgtggtcatgcttctcctaactgcaaggctaacgctg
tccagcccggctcctcctgcttgtgacctccgagtcctcagtaaactgcttcgtgactcc
catgtccttcacagcagactgagccagtgcccagaggttcaccctttgcctacacctgtc
ctgctgcctgctgtggactttagcttgggagaatggaaaacccagatggaggagaccaag
gcacaggacattctgggagcagtgacccttctgctggagggagtgatggcagcacgggga
caactgggacccacttgcctctcatccctcctggggcagctttctggacaggtccgtctc
ctccttggggccctgcagagcctccttggaacccagcttcctccacagggcaggaccaca
gctcacaaggatcccaatgccatcttcctgagcttccaacacctgctccgaggaaaggtg
cgtttcctgatgcttgtaggagggtccaccctctgcgtcaggcgggccccacccaccaca
gctgtccccagcagaacctctctagtcctcacactgaacgagctcccaaacaggacttct
ggattgttggagacaaacttcactgcctcagccagaactactggctctgggcttctgaag
tggcagcagggattcagagccaagattcctggtctgctgaaccaaacctccaggtccctg
gaccaaatccccggatacctgaacaggatacacgaactcttgaatggaactcgtggactc
tttcctggaccctcacgcaggaccctaggagccccggacatttcctcaggaacatcagac
acaggctccctgccacccaacctccagcctggatattctccttccccaacccatcctcct
actggacagtatacgctcttccctcttccacccaccttgcccacccctgtggtccagctc
caccccctgcttcctgacccttctgctccaacgcccacccctaccagccctcttctaaac
acatcctacacccactcccagaatctgtctcaggaagggtaa

DBGET integrated database retrieval system