KEGG   Homo sapiens (human): 1440
Entry
1440              CDS       T01001                                 
Symbol
CSF3, C17orf33, CSF3OS, GCSF, G-CSF
Name
(RefSeq) colony stimulating factor 3
  KO
K05423  granulocyte colony-stimulating factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04657  IL-17 signaling pathway
hsa05144  Malaria
hsa05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1440 (CSF3)
   04151 PI3K-Akt signaling pathway
    1440 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1440 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1440 (CSF3)
   04657 IL-17 signaling pathway
    1440 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    1440 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    1440 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1440 (CSF3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1440 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 NAGLU Img2
Other DBs
NCBI-GeneID: 1440
NCBI-ProteinID: NP_000750
OMIM: 138970
HGNC: 2438
Ensembl: ENSG00000108342
Pharos: P09919(Tbio)
UniProt: P09919 Q8N4W3
Structure
LinkDB
Position
17:40015440..40017813
AA seq 207 aa
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA
LQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQG
LLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRR
AGGVLVASHLQSFLEVSYRVLRHLAQP
NT seq 624 nt   +upstreamnt  +downstreamnt
atggctggacctgccacccagagccccatgaagctgatggccctgcagctgctgctgtgg
cacagtgcactctggacagtgcaggaagccacccccctgggccctgccagctccctgccc
cagagcttcctgctcaagtgcttagagcaagtgaggaagatccagggcgatggcgcagcg
ctccaggagaagctggtgagtgagtgtgccacctacaagctgtgccaccccgaggagctg
gtgctgctcggacactctctgggcatcccctgggctcccctgagcagctgccccagccag
gccctgcagctggcaggctgcttgagccaactccatagcggccttttcctctaccagggg
ctcctgcaggccctggaagggatctcccccgagttgggtcccaccttggacacactgcag
ctggacgtcgccgactttgccaccaccatctggcagcagatggaagaactgggaatggcc
cctgccctgcagcccacccagggtgccatgccggccttcgcctctgctttccagcgccgg
gcaggaggggtcctggttgcctcccatctgcagagcttcctggaggtgtcgtaccgcgtt
ctacgccaccttgcccagccctga

KEGG   Homo sapiens (human): 1442
Entry
1442              CDS       T01001                                 
Symbol
CSH1, CS-1, CSA, CSMT, GHB3, PL, hCS-1, hCS-A
Name
(RefSeq) chorionic somatomammotropin hormone 1
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1442 (CSH1)
   04151 PI3K-Akt signaling pathway
    1442 (CSH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1442 (CSH1)
   04060 Cytokine-cytokine receptor interaction
    1442 (CSH1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    1442 (CSH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1442 (CSH1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1442 (CSH1)
SSDB
Motif
Pfam: Hormone_1 PCLP
Other DBs
NCBI-GeneID: 1442
NCBI-ProteinID: NP_001308
OMIM: 150200
HGNC: 2440
Ensembl: ENSG00000136488
Pharos: P0DML2(Tbio)
CPD: C18210
UniProt: P0DML2 P0DML3 A8K6C2
Structure
LinkDB
Position
17:complement(63894918..63896574)
AA seq 217 aa
MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctccaggctcccggacgtccctgctcctggcttttgccctgctctgcctgccctgg
cttcaagaggctggtgccgtccaaaccgttcccttatccaggctttttgaccacgctatg
ctccaagcccatcgcgcgcaccagctggccattgacacctaccaggagtttgaagaaacc
tatatcccaaaggaccagaagtattcattcctgcatgactcccagacctccttctgcttc
tcagactctattccgacaccctccaacatggaggaaacgcaacagaaatccaatctagag
ctgctccgcatctccctgctgctcatcgagtcgtggctggagcccgtgcggttcctcagg
agtatgttcgccaacaacctggtgtatgacacctcggacagcgatgactatcacctccta
aaggacctagaggaaggcatccaaacgctgatggggaggctggaagacggcagccgccgg
actgggcagatcctcaagcagacctacagcaagtttgacacaaactcgcacaaccatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatggtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Homo sapiens (human): 1443
Entry
1443              CDS       T01001                                 
Symbol
CSH2, CS-2, CSB, GHB1, PL, hCS-B
Name
(RefSeq) chorionic somatomammotropin hormone 2
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    1443 (CSH2)
   04151 PI3K-Akt signaling pathway
    1443 (CSH2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1443 (CSH2)
   04060 Cytokine-cytokine receptor interaction
    1443 (CSH2)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    1443 (CSH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1443 (CSH2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1443 (CSH2)
SSDB
Motif
Pfam: Hormone_1 PCLP
Other DBs
NCBI-GeneID: 1443
NCBI-ProteinID: NP_066271
OMIM: 118820
HGNC: 2441
Ensembl: ENSG00000213218
Pharos: P0DML3(Tbio)
UniProt: P0DML3 A0A0M6L0F6
LinkDB
Position
17:complement(63872012..63873729)
AA seq 217 aa
MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEET
YIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLR
SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHD
ALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacgtccctgctcctggcttttgccctgctctgcctgccctgg
cttcaagaggctggtgccgtccaaaccgttccgttatccaggctttttgaccacgctatg
ctccaagcccatcgcgcgcaccagctggccattgacacctaccaggagtttgaagaaacc
tatatcccaaaggaccagaagtattcattcctgcatgactcccagacctccttctgcttc
tcagactctattccgacaccctccaacatggaggaaacgcaacagaaatccaatctagag
ctgctccgcatctccctgctgctcatcgagtcgtggctggagcccgtgcggttcctcagg
agtatgttcgccaacaacctggtgtatgacacctcggacagcgatgactatcacctccta
aaggacctagaggaaggcatccaaacgctgatggggaggctggaagacggcagccgccgg
actgggcagatcctcaagcagacctacagcaagtttgacacaaactcacacaaccatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatggtgcagtgccgctctgtagagggtagctgtggcttctag

KEGG   Homo sapiens (human): 2056
Entry
2056              CDS       T01001                                 
Symbol
EPO, DBAL, ECYT5, EP, MVCD2
Name
(RefSeq) erythropoietin
  KO
K05437  erythropoietin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Network
nt06119  JAK-STAT signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00236  Congenital polycythemia
H01360  Allergic rhinitis
H01457  Diabetic retinopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    2056 (EPO)
   04066 HIF-1 signaling pathway
    2056 (EPO)
   04151 PI3K-Akt signaling pathway
    2056 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2056 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2056 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2056 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2056 (EPO)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   2056 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 2056
NCBI-ProteinID: NP_000790
OMIM: 133170
HGNC: 3415
Ensembl: ENSG00000130427
Pharos: P01588(Tbio)
CPD: C18200
UniProt: P01588 G9JKG7
Structure
LinkDB
Position
7:100720468..100723700
AA seq 193 aa
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENITTGCAEHC
SLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL
HVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKL
KLYTGEACRTGDR
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggggtgcacgaatgtcctgcctggctgtggcttctcctgtccctgctgtcgctccct
ctgggcctcccagtcctgggcgccccaccacgcctcatctgtgacagccgagtcctggag
aggtacctcttggaggccaaggaggccgagaatatcacgacgggctgtgctgaacactgc
agcttgaatgagaatatcactgtcccagacaccaaagttaatttctatgcctggaagagg
atggaggtcgggcagcaggccgtagaagtctggcagggcctggccctgctgtcggaagct
gtcctgcggggccaggccctgttggtcaactcttcccagccgtgggagcccctgcagctg
catgtggataaagccgtcagtggccttcgcagcctcaccactctgcttcgggctctggga
gcccagaaggaagccatctcccctccagatgcggcctcagctgctccactccgaacaatc
actgctgacactttccgcaaactcttccgagtctactccaatttcctccggggaaagctg
aagctgtacacaggggaggcctgcaggacaggggacagatga

KEGG   Homo sapiens (human): 2688
Entry
2688              CDS       T01001                                 
Symbol
GH1, GH, GH-N, GHB5, GHN, IGHD1A, IGHD1B, IGHD2, hGH-N
Name
(RefSeq) growth hormone 1
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Network
nt06324  GHRH-GH-IGF signaling
  Element
N00907  GH-Jak-STAT signaling pathway
N00908  Mutation-inactivated GH to GH-Jak-STAT signaling pathway
N00909  Mutation-inactivated GHR to GH-Jak-STAT signaling pathway
N00910  GHRHR-PKA-GH signaling pathway
N00912  Mutation-activated GNAS to GHRHR-PKA-GH signaling pathway
Disease
H00254  Growth hormone deficiency
H02035  Isolated growth hormone deficiency
H02039  Kowarski syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    2688 (GH1)
   04151 PI3K-Akt signaling pathway
    2688 (GH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2688 (GH1)
   04060 Cytokine-cytokine receptor interaction
    2688 (GH1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    2688 (GH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2688 (GH1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   2688 (GH1)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 2688
NCBI-ProteinID: NP_000506
OMIM: 139250
HGNC: 4261
Ensembl: ENSG00000259384
Pharos: P01241(Tbio)
CPD: C18181
UniProt: P01241 B1A4G6
Structure
LinkDB
Position
17:complement(63917203..63918839)
AA seq 217 aa
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctacaggctcccggacgtccctgctcctggcttttggcctgctctgcctgccctgg
cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaacgctatg
ctccgcgcccatcgtctgcaccagctggcctttgacacctaccaggagtttgaagaagcc
tatatcccaaaggaacagaagtattcattcctgcagaacccccagacctccctctgtttc
tcagagtctattccgacaccctccaacagggaggaaacacaacagaaatccaacctagag
ctgctccgcatctccctgctgctcatccagtcgtggctggagcccgtgcagttcctcagg
agtgtcttcgccaacagcctggtgtacggcgcctctgacagcaacgtctatgacctccta
aaggacctagaggaaggcatccaaacgctgatggggaggctggaagatggcagcccccgg
actgggcagatcttcaagcagacctacagcaagttcgacacaaactcacacaacgatgac
gcactactcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatcgtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Homo sapiens (human): 2689
Entry
2689              CDS       T01001                                 
Symbol
GH2, GH-V, GHB2, GHL, GHV, hGH-V
Name
(RefSeq) growth hormone 2
  KO
K05438  growth hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
Network
nt06324  GHRH-GH-IGF signaling
  Element
N00907  GH-Jak-STAT signaling pathway
N00909  Mutation-inactivated GHR to GH-Jak-STAT signaling pathway
N00910  GHRHR-PKA-GH signaling pathway
N00912  Mutation-activated GNAS to GHRHR-PKA-GH signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    2689 (GH2)
   04151 PI3K-Akt signaling pathway
    2689 (GH2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2689 (GH2)
   04060 Cytokine-cytokine receptor interaction
    2689 (GH2)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    2689 (GH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2689 (GH2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   2689 (GH2)
SSDB
Motif
Pfam: Hormone_1 DUF594
Other DBs
NCBI-GeneID: 2689
NCBI-ProteinID: NP_002050
OMIM: 139240
HGNC: 4262
Ensembl: ENSG00000136487
Pharos: P01242(Tbio)
UniProt: P01242 A0A0M6L0J9
LinkDB
Position
17:complement(63880215..63881944)
AA seq 217 aa
MAAGSRTSLLLAFGLLCLSWLQEGSAFPTIPLSRLFDNAMLRARRLYQLAYDTYQEFEEA
YILKEQKYSFLQNPQTSLCFSESIPTPSNRVKTQQKSNLELLRISLLLIQSWLEPVQLLR
SVFANSLVYGASDSNVYRHLKDLEEGIQTLMWRLEDGSPRTGQIFNQSYSKFDTKSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacgtccctgctcctggcttttggcctgctctgcctgtcctgg
cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaacgctatg
ctccgcgcccgtcgcctgtaccagctggcatatgacacctatcaggagtttgaagaagcc
tatatcctgaaggagcagaagtattcattcctgcagaacccccagacctccctctgcttc
tcagagtctattccaacaccttccaacagggtgaaaacgcagcagaaatctaacctagag
ctgctccgcatctccctgctgctcatccagtcatggctggagcccgtgcagctcctcagg
agcgtcttcgccaacagcctggtgtatggcgcctcggacagcaacgtctatcgccacctg
aaggacctagaggaaggcatccaaacgctgatgtggaggctggaagatggcagcccccgg
actgggcagatcttcaatcagtcctacagcaagtttgacacaaaatcgcacaacgatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatcgtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Homo sapiens (human): 3439
Entry
3439              CDS       T01001                                 
Symbol
IFNA1, IFL, IFN, IFN-ALPHA, IFN-alphaD, IFNA13, IFNA@, leIF_D
Name
(RefSeq) interferon alpha 1
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04936  Alcoholic liver disease
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
hsa05417  Lipid and atherosclerosis
Network
nt06119  JAK-STAT signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06219  JAK-STAT signaling
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3439 (IFNA1)
   04151 PI3K-Akt signaling pathway
    3439 (IFNA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3439 (IFNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3439 (IFNA1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3439 (IFNA1)
   04621 NOD-like receptor signaling pathway
    3439 (IFNA1)
   04622 RIG-I-like receptor signaling pathway
    3439 (IFNA1)
   04623 Cytosolic DNA-sensing pathway
    3439 (IFNA1)
   04650 Natural killer cell mediated cytotoxicity
    3439 (IFNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3439 (IFNA1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3439 (IFNA1)
   05161 Hepatitis B
    3439 (IFNA1)
   05160 Hepatitis C
    3439 (IFNA1)
   05171 Coronavirus disease - COVID-19
    3439 (IFNA1)
   05164 Influenza A
    3439 (IFNA1)
   05162 Measles
    3439 (IFNA1)
   05168 Herpes simplex virus 1 infection
    3439 (IFNA1)
   05163 Human cytomegalovirus infection
    3439 (IFNA1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3439 (IFNA1)
   05169 Epstein-Barr virus infection
    3439 (IFNA1)
   05165 Human papillomavirus infection
    3439 (IFNA1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3439 (IFNA1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3439 (IFNA1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3439 (IFNA1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3439 (IFNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3439 (IFNA1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3439 (IFNA1)
SSDB
Motif
Pfam: Interferon iSTAND CBF
Other DBs
NCBI-GeneID: 3439
NCBI-ProteinID: NP_076918
OMIM: 147660
HGNC: 5417
Ensembl: ENSG00000197919
Pharos: P01562(Tbio)
UniProt: P01562 L0N195
Structure
LinkDB
Position
9:21440439..21441316
AA seq 189 aa
MASPFALLMVLVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFG
FPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLE
ACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcctcgccctttgctttactgatggtcctggtggtgctcagctgcaagtcaagctgc
tctctgggctgtgatctccctgagacccacagcctggataacaggaggaccttgatgctc
ctggcacaaatgagcagaatctctccttcctcctgtctgatggacagacatgactttgga
tttccccaggaggagtttgatggcaaccagttccagaaggctccagccatctctgtcctc
catgagctgatccagcagatcttcaacctctttaccacaaaagattcatctgctgcttgg
gatgaggacctcctagacaaattctgcaccgaactctaccagcagctgaatgacttggaa
gcctgtgtgatgcaggaggagagggtgggagaaactcccctgatgaatgcggactccatc
ttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttatcaacaaac
ttgcaagaaagattaaggaggaaggaataa

KEGG   Homo sapiens (human): 3440
Entry
3440              CDS       T01001                                 
Symbol
IFNA2, IFN-alpha-2, IFN-alphaA, IFNA, IFNA2B, leIF_A
Name
(RefSeq) interferon alpha 2
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04936  Alcoholic liver disease
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
hsa05417  Lipid and atherosclerosis
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3440 (IFNA2)
   04151 PI3K-Akt signaling pathway
    3440 (IFNA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3440 (IFNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3440 (IFNA2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3440 (IFNA2)
   04621 NOD-like receptor signaling pathway
    3440 (IFNA2)
   04622 RIG-I-like receptor signaling pathway
    3440 (IFNA2)
   04623 Cytosolic DNA-sensing pathway
    3440 (IFNA2)
   04650 Natural killer cell mediated cytotoxicity
    3440 (IFNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3440 (IFNA2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3440 (IFNA2)
   05161 Hepatitis B
    3440 (IFNA2)
   05160 Hepatitis C
    3440 (IFNA2)
   05171 Coronavirus disease - COVID-19
    3440 (IFNA2)
   05164 Influenza A
    3440 (IFNA2)
   05162 Measles
    3440 (IFNA2)
   05168 Herpes simplex virus 1 infection
    3440 (IFNA2)
   05163 Human cytomegalovirus infection
    3440 (IFNA2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3440 (IFNA2)
   05169 Epstein-Barr virus infection
    3440 (IFNA2)
   05165 Human papillomavirus infection
    3440 (IFNA2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3440 (IFNA2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3440 (IFNA2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3440 (IFNA2)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3440 (IFNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3440 (IFNA2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3440 (IFNA2)
SSDB
Motif
Pfam: Interferon CBF iSTAND APC1_C DDHD ORF6C
Other DBs
NCBI-GeneID: 3440
NCBI-ProteinID: NP_000596
OMIM: 147562
HGNC: 5423
Ensembl: ENSG00000188379
Pharos: P01563(Tbio)
UniProt: P01563 A0A7R8GUN5
Structure
LinkDB
Position
9:complement(21384255..21385398)
AA seq 188 aa
MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFG
FPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEA
CVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNL
QESLRSKE
NT seq 567 nt   +upstreamnt  +downstreamnt
atggccttgacctttgctttactggtggccctcctggtgctcagctgcaagtcaagctgc
tctgtgggctgtgatctgcctcaaacccacagcctgggtagcaggaggaccttgatgctc
ctggcacagatgaggagaatctctcttttctcctgcttgaaggacagacatgactttgga
tttccccaggaggagtttggcaaccagttccaaaaggctgaaaccatccctgtcctccat
gagatgatccagcagatcttcaatctcttcagcacaaaggactcatctgctgcttgggat
gagaccctcctagacaaattctacactgaactctaccagcagctgaatgacctggaagcc
tgtgtgatacagggggtgggggtgacagagactcccctgatgaaggaggactccattctg
gctgtgaggaaatacttccaaagaatcactctctatctgaaagagaagaaatacagccct
tgtgcctgggaggttgtcagagcagaaatcatgagatctttttctttgtcaacaaacttg
caagaaagtttaagaagtaaggaatga

KEGG   Homo sapiens (human): 3441
Entry
3441              CDS       T01001                                 
Symbol
IFNA4, IFN-alpha4a, INFA4
Name
(RefSeq) interferon alpha 4
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04936  Alcoholic liver disease
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
hsa05417  Lipid and atherosclerosis
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3441 (IFNA4)
   04151 PI3K-Akt signaling pathway
    3441 (IFNA4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3441 (IFNA4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3441 (IFNA4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3441 (IFNA4)
   04621 NOD-like receptor signaling pathway
    3441 (IFNA4)
   04622 RIG-I-like receptor signaling pathway
    3441 (IFNA4)
   04623 Cytosolic DNA-sensing pathway
    3441 (IFNA4)
   04650 Natural killer cell mediated cytotoxicity
    3441 (IFNA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3441 (IFNA4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3441 (IFNA4)
   05161 Hepatitis B
    3441 (IFNA4)
   05160 Hepatitis C
    3441 (IFNA4)
   05171 Coronavirus disease - COVID-19
    3441 (IFNA4)
   05164 Influenza A
    3441 (IFNA4)
   05162 Measles
    3441 (IFNA4)
   05168 Herpes simplex virus 1 infection
    3441 (IFNA4)
   05163 Human cytomegalovirus infection
    3441 (IFNA4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3441 (IFNA4)
   05169 Epstein-Barr virus infection
    3441 (IFNA4)
   05165 Human papillomavirus infection
    3441 (IFNA4)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3441 (IFNA4)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3441 (IFNA4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3441 (IFNA4)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3441 (IFNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3441 (IFNA4)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3441 (IFNA4)
SSDB
Motif
Pfam: Interferon iSTAND
Other DBs
NCBI-GeneID: 3441
NCBI-ProteinID: NP_066546
OMIM: 147564
HGNC: 5425
Ensembl: ENSG00000236637
Pharos: P05014(Tbio)
UniProt: P05014
LinkDB
Position
9:complement(21186618..21187587)
AA seq 189 aa
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFG
FPEEEFDGHQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcatttctcctgcctgaaggacagacatgatttcgga
ttccccgaggaggagtttgatggccaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacagaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa
gcatgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctttatctaacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctcgttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Homo sapiens (human): 3442
Entry
3442              CDS       T01001                                 
Symbol
IFNA5, IFN-alpha-5, IFN-alphaG, INA5, INFA5, leIF_G
Name
(RefSeq) interferon alpha 5
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04936  Alcoholic liver disease
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
hsa05417  Lipid and atherosclerosis
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3442 (IFNA5)
   04151 PI3K-Akt signaling pathway
    3442 (IFNA5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3442 (IFNA5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3442 (IFNA5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3442 (IFNA5)
   04621 NOD-like receptor signaling pathway
    3442 (IFNA5)
   04622 RIG-I-like receptor signaling pathway
    3442 (IFNA5)
   04623 Cytosolic DNA-sensing pathway
    3442 (IFNA5)
   04650 Natural killer cell mediated cytotoxicity
    3442 (IFNA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3442 (IFNA5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3442 (IFNA5)
   05161 Hepatitis B
    3442 (IFNA5)
   05160 Hepatitis C
    3442 (IFNA5)
   05171 Coronavirus disease - COVID-19
    3442 (IFNA5)
   05164 Influenza A
    3442 (IFNA5)
   05162 Measles
    3442 (IFNA5)
   05168 Herpes simplex virus 1 infection
    3442 (IFNA5)
   05163 Human cytomegalovirus infection
    3442 (IFNA5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3442 (IFNA5)
   05169 Epstein-Barr virus infection
    3442 (IFNA5)
   05165 Human papillomavirus infection
    3442 (IFNA5)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3442 (IFNA5)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3442 (IFNA5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3442 (IFNA5)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3442 (IFNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3442 (IFNA5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3442 (IFNA5)
SSDB
Motif
Pfam: Interferon CBF iSTAND
Other DBs
NCBI-GeneID: 3442
NCBI-ProteinID: NP_002160
OMIM: 147565
HGNC: 5426
Ensembl: ENSG00000147873
Pharos: P01569(Tbio)
UniProt: P01569 A0A7R8C382
LinkDB
Position
9:complement(21304326..21305313)
AA seq 189 aa
MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLE
ACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSAN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgccctttgttttactgatggccctggtggtgctcaactgcaagtcaatctgt
tctctgggctgtgatctgcctcagacccacagcctgagtaacaggaggactttgatgata
atggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgga
tttcctcaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctacttgg
gatgagacacttctagacaaattctacactgaactttaccagcagctgaatgacctggaa
gcctgtatgatgcaggaggttggagtggaagacactcctctgatgaatgtggactctatc
ctgactgtgagaaaatactttcaaagaatcaccctctatctgacagagaagaaatacagc
ccttgtgcatgggaggttgtcagagcagaaatcatgagatccttctctttatcagcaaac
ttgcaagaaagattaaggaggaaggaatga

DBGET integrated database retrieval system