KEGG   Homo sapiens (human): 144165
Entry
144165            CDS       T01001                                 
Symbol
PRICKLE1, EPM1B, RILP
Name
(RefSeq) prickle planar cell polarity protein 1
  KO
K04511  prickle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Disease
H00810  Progressive myoclonic epilepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    144165 (PRICKLE1)
SSDB
Motif
Pfam: PET LIM Vasculin
Other DBs
NCBI-GeneID: 144165
NCBI-ProteinID: NP_001138353
OMIM: 608500
HGNC: 17019
Ensembl: ENSG00000139174
Pharos: Q96MT3(Tbio)
UniProt: Q96MT3 A0A024R0W7 B3KVG3
LinkDB
Position
12:complement(42456757..42589746)
AA seq 831 aa
MPLEMEPKMSKLAFGCQRSSTSDDDSGCALEEYAWVPPGLRPEQIQLYFACLPEEKVPYV
NSPGEKHRIKQLLYQLPPHDNEVRYCQSLSEEEKKELQVFSAQRKKEALGRGTIKLLSRA
VMHAVCEQCGLKINGGEVAVFASRAGPGVCWHPSCFVCFTCNELLVDLIYFYQDGKIHCG
RHHAELLKPRCSACDEIIFADECTEAEGRHWHMKHFCCLECETVLGGQRYIMKDGRPFCC
GCFESLYAEYCETCGEHIGVDHAQMTYDGQHWHATEACFSCAQCKASLLGCPFLPKQGQI
YCSKTCSLGEDVHASDSSDSAFQSARSRDSRRSVRMGKSSRSADQCRQSLLLSPALNYKF
PGLSGNADDTLSRKLDDLSLSRQGTSFASEEFWKGRVEQETPEDPEEWADHEDYMTQLLL
KFGDKSLFQPQPNEMDIRASEHWISDNMVKSKTELKQNNQSLASKKYQSDMYWAQSQDGL
GDSAYGSHPGPASSRRLQELELDHGASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSL
ALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEKMSNMGTLNSSMLHRSAESLKSLSS
ELCPEKILPEEKPVHLPVLRRSKSQSRPQQVKFSDDVIDNGNYDIEIRQPPMSERTRRRV
YNFEERGSRSHHHRRRRSRKSRSDNALNLVTERKYSPKDRLRLYTPDNYEKFIQNKSARE
IQAYIQNADLYGQYAHATSDYGLQNPGMNRFLGLYGEDDDSWCSSSSSSSDSEEEGYFLG
QPIPQPRPQRFAYYTDDLSSPPSALPTPQFGQRTTKSKKKKGHKGKNCIIS
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgcctttggagatggagcccaagatgagcaaactggcctttggctgtcagagaagttcc
acatcagatgatgactctggctgtgcattggaggagtacgcctgggtccccccgggcctg
agaccagagcagatccagctctattttgcttgcttaccagaggaaaaagttccttacgtt
aacagccccggagagaagcatcggattaaacagcttttgtaccagttaccaccacatgat
aatgaggtacggtattgccagtctttgagtgaagaggagaaaaaagagttgcaggtgttc
agtgctcagcggaagaaagaagcactgggaagaggaacaattaagcttctgtccagagca
gtcatgcatgctgtgtgtgagcagtgtggtttgaagataaatggaggtgaagttgcagtg
ttcgcctcccgtgcgggccctggtgtgtgctggcacccatcctgttttgtctgtttcacg
tgtaatgagctgctggtcgacctcatctatttttatcaggatggaaaaattcactgtggc
aggcaccatgcagaactgctcaaaccacggtgctcagcatgtgacgagataatttttgct
gatgagtgcacagaagctgagggtcgccattggcacatgaaacacttctgctgccttgag
tgtgaaacggtcctgggaggacagaggtatatcatgaaggacggccgccccttctgctgt
ggctgttttgagtctctctatgcggagtactgtgaaacctgtggggaacatattggtgtg
gaccatgcacagatgacctatgacgggcagcactggcacgccacggaagcctgcttttct
tgtgcccagtgtaaagcctctttgttgggatgtcccttccttcccaaacagggtcagatt
tactgctcaaaaacgtgcagtcttggtgaagacgtccatgcctctgattcttccgactct
gcatttcagtcagctcgatcaagagactcccgaagaagtgtccgaatgggcaagagcagc
cggtcagcagatcagtgtagacagtctctcctcttatcgcctgctctgaactacaagttt
cctggcctctcaggcaatgctgatgacaccctttctcgaaaattggatgatctgagtctc
tccagacaaggaacaagttttgccagtgaagaattttggaaaggcagagtagagcaggaa
actccagaagaccctgaagaatgggctgatcatgaagattatatgacgcagctcctcctc
aagtttggtgataaaagcctctttcagccacagcccaatgagatggatattcgagccagt
gagcactggatatctgataacatggttaaaagtaagaccgagttaaagcaaaataaccag
agccttgcaagtaaaaaataccagtctgatatgtactgggcacagtcacaagatggactg
ggcgattctgcttatggcagccacccaggccctgcaagcagtagaaggcttcaggaattg
gaactggaccatggggcttcagggtataatcatgatgaaacacagtggtatgaagattcc
ctggagtgtctgtcagacctgaaaccagagcaaagtgttcgggattcgatggattctttg
gcattgtccaatatcacaggggcttcggtggatggagaaaacaagccaaggccatcattg
tattctctgcaaaattttgaggagatggaaacagaagattgtgagaagatgagcaatatg
ggaactttgaactcttccatgctgcacaggagtgcagagtccttaaagagtctaagttca
gagttgtgtccagagaaaatcctgcctgaagagaagccagtacatctgccagtgctcaga
aggtccaagtctcaatccagaccccagcaggtcaagttttctgatgatgtcattgacaat
gggaactatgacattgaaatccggcagcctccgatgagtgaaaggactcggagacgcgtc
tacaattttgaagagaggggatccaggtctcatcaccaccgccgccggagaagtagaaag
tcccgctccgacaatgccctgaatcttgttacagaaagaaaatactctcccaaggacaga
ctgcggctgtacacccccgataactatgagaaatttatacagaataaaagtgcccgggag
atccaagcatacatccagaatgctgatctctacggacagtacgcccatgccacttccgat
tatggcctgcagaacccaggaatgaatcggtttctgggactctacggcgaggatgatgat
tcctggtgttcttcctcctcctcctcttccgactcggaagaagaaggatattttcttgga
caaccaatccctcaaccccggccacagagatttgcctactatacagatgacctttctagt
ccaccatctgcacttcccacccctcagtttggtcagaggacaacaaaatccaagaagaaa
aagggacacaagggcaaaaattgtattatttcttaa

KEGG   Homo sapiens (human): 166336
Entry
166336            CDS       T01001                                 
Symbol
PRICKLE2, EPM5
Name
(RefSeq) prickle planar cell polarity protein 2
  KO
K04511  prickle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Disease
H00810  Progressive myoclonic epilepsy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    166336 (PRICKLE2)
SSDB
Motif
Pfam: PET LIM
Other DBs
NCBI-GeneID: 166336
NCBI-ProteinID: NP_942559
OMIM: 608501
HGNC: 20340
Ensembl: ENSG00000163637
Pharos: Q7Z3G6(Tdark)
UniProt: Q7Z3G6 A1LQZ3
LinkDB
Position
3:complement(64092236..64268173)
AA seq 844 aa
MVTVMPLEMEKTISKLMFDFQRNSTSDDDSGCALEEYAWVPPGLKPEQVHQYYSCLPEEK
VPYVNSPGEKLRIKQLLHQLPPHDNEVRYCNSLDEEEKRELKLFSSQRKRENLGRGNVRP
FPVTMTGAICEQCGGQINGGDIAVFASRAGHGVCWHPPCFVCTVCNELLVDLIYFYQDGK
IYCGRHHAECLKPRCAACDEIIFADECTEAEGRHWHMKHFCCFECETVLGGQRYIMKEGR
PYCCHCFESLYAEYCDTCAQHIGIDQGQMTYDGQHWHATETCFCCAHCKKSLLGRPFLPK
QGQIFCSRACSAGEDPNGSDSSDSAFQNARAKESRRSAKIGKNKGKTEEPMLNQHSQLQV
SSNRLSADVDPLSLQMDMLSLSSQTPSLNRDPIWRSREEPYHYGNKMEQNQTQSPLQLLS
QCNIRTSYSPGGQGAGAQPEMWGKHFSNPKRSSSLAMTGHAGSFIKECREDYYPGRLRSQ
ESYSDMSSQSFSETRGSIQVPKYEEEEEEEGGLSTQQCRTRHPISSLKYTEDMTPTEQTP
RGSMESLALSNATGLSADGGAKRQEHLSRFSMPDLSKDSGMNVSEKLSNMGTLNSSMQFR
SAESVRSLLSAQQYQEMEGNLHQLSNPIGYRDLQSHGRMHQSFDFDGGMAGSKLPGQEGV
RIQPMSERTRRRATSRDDNRRFRPHRSRRSRRSRSDNALHLASEREAISRLKDRPPLRAR
EDYDQFMRQRSFQESMGHGSRRDLYGQCPRTVSDLALQNAFGDRWGPYFAEYDWCSTCSS
SSESDNEGYFLGEPIPQPARLRYVTSDELLHKYSSYGLPKSSTLGGRGQLHSRKRQKSKN
CIIS
NT seq 2535 nt   +upstreamnt  +downstreamnt
atggtgacagtgatgccgctggagatggagaagaccatcagcaaactcatgtttgacttt
cagaggaactcgacctcagatgatgactcaggctgtgctttggaagagtatgcctgggtc
ccgccgggtctgaagcctgaacaggtacaccagtactatagctgtctcccagaagagaaa
gtcccttatgtcaacagtcctggagagaaactgcgaatcaagcagctactacaccagctg
ccgccacatgacaatgaggttcgatattgcaactccctggatgaggaagagaagagggag
ctgaagcttttcagcagccagaggaaacgcgaaaacttgggccgcgggaatgtcaggcct
ttcccagtcaccatgacaggagctatttgtgaacagtgcggaggccagatcaatggtgga
gacatcgctgtgtttgcgtcacgcgctggccacggcgtttgctggcacccgccgtgcttc
gtatgcactgtctgcaatgagctcctggtggatctgatctacttttaccaagatgggaag
atatactgtggcaggcaccatgctgagtgcctgaagccgcgctgtgctgcctgcgatgag
atcatctttgcagatgaatgcacagaagctgaggggcgacactggcacatgaaacacttt
tgctgcttcgagtgtgagacagtgctgggcggccagcgctacatcatgaaggagggaaga
ccctactgttgccactgcttcgagtccttgtatgcagaatattgtgacacctgtgcccaa
catataggtatcgaccaaggtcaaatgacctatgatggccaacactggcatgccactgag
acctgtttctgctgtgctcactgcaagaaatccctcctggggcggccattcctcccgaag
cagggccagatattctgctcacgggcctgcagtgctggggaagaccccaatggttctgac
tcctctgattccgccttccagaacgccagggccaaggagtcccggcgcagtgccaaaatt
ggcaagaacaagggcaagacggaggagcccatgctgaaccagcacagccagctgcaagtg
agttctaaccggctgtcagccgacgtagaccccctgtcactgcagatggacatgctcagc
ctgtccagccagacacccagcctcaaccgggaccccatctggaggagccgggaagagccc
taccattatgggaacaagatggagcagaaccagacccagagccctctgcagctcctcagc
cagtgcaacatcagaacttcctacagtccaggagggcaaggggctggggcccagcccgaa
atgtggggcaagcacttcagcaaccccaaaaggagctcgtcactggccatgacaggacat
gctggcagcttcatcaaggaatgccgagaagactattacccggggaggctgagatctcag
gagagctacagtgatatgtctagtcagagtttcagtgagacccgaggcagcatccaagtc
cccaaatatgaggaggaagaggaagaggaagggggcttgtccactcagcagtgtcggacc
cgtcatcccatcagttccctgaaatacacagaggacatgacgcccacagagcagacccct
cggggctccatggaatccctggccctgtctaatgcaacaggcctctctgctgatggtggt
gccaagcgccaggagcacctatcccgattttccatgcctgacctcagcaaagactctgga
atgaatgtgtctgagaagctgagcaacatgggcactcttaactcgtccatgcagttccgg
agcgcagagtcagttcgcagcctgctctctgcccagcagtaccaggagatggagggaaac
ctccaccagctcagcaaccccattggctacagagacctgcagtcccacggaaggatgcat
cagagctttgattttgatggagggatggcgggcagcaagctgccagggcaggagggcgtg
aggatccagcccatgagtgaacgcacccggagaagagctacttcacgcgacgacaaccgc
cgtttccgacctcacaggtccaggcgttcccgacgctctcgctccgacaacgccctccac
ctggccagcgaacgcgaggccatctcccggttaaaagataggccccctctgagagccagg
gaggactatgaccaatttatgcgccagcggagcttccaggagagcatggggcatgggtcc
cggagggacctgtacggccagtgccctaggactgtgtcggacctggctttgcagaatgcc
tttggggaccgctggggaccctacttcgccgagtatgattggtgttccacctgctcctcc
tcttcagagtctgacaacgagggctatttcctaggagaacccatcccccagccagcgcgc
ctgcgatacgtcacaagcgatgagctgctgcacaaatacagctcctacggcctccccaaa
tcttccacattaggtggcagaggacagttgcacagcaggaaaagacagaagagcaaaaac
tgtatcatttcttaa

KEGG   Homo sapiens (human): 29964
Entry
29964             CDS       T01001                                 
Symbol
PRICKLE4, C6orf49, OBTP, OEBT, TOMM6
Name
(RefSeq) prickle planar cell polarity protein 4
  KO
K04511  prickle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    29964 (PRICKLE4)
SSDB
Motif
Pfam: LIM PET
Other DBs
NCBI-GeneID: 29964
NCBI-ProteinID: NP_037529
OMIM: 611389
HGNC: 16805
Ensembl: ENSG00000278224
Pharos: Q2TBC4(Tdark)
UniProt: Q2TBC4
LinkDB
Position
6:41780782..41787452
AA seq 384 aa
MSVQNSGWPHQEDSPKPQDPGPPANSDSDSGHLPGEDPEDTHAQGPAVLSLGSLCLDTNQ
APNWTGLQTLLQQLPPQDIDERYCLALGEEERAELQLFCARRKQEALGQGVARLVLPKLE
GHTCEKCRELLKPGEYGVFAARAGEQRCWHQPCFACQACGQALINLIYFYHDGQLYCGRH
HAELLRPRCPACDQLIFSWRCTEAEGQRWHENHFCCQDCAGPLGGGRYALPGGSPCCPSC
FENRYSDAGSSWAGALEGQAFLGETGLDRTEGRDQTSVNSATLSRTLLAAAGGSSLQTQR
GLPGSSPQQENRPGDKAEAPKGQEQCRLETIRDPKDTPFSTCSSSSDSEPEGFFLGERLP
QSWKTPGSLQAEDSNASKTHCTMC
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgtcagtgcagaactctggctggccccaccaagaagacagccccaagccccaggatcca
ggtccaccagccaactcagacagtgactcaggccacctgccgggggaggaccctgaggat
acccatgctcagggtcctgcagttctgagcttgggttccctttgcctggacaccaaccaa
gcccccaactggactggacttcagaccctcctgcagcaactccctccgcaggacattgat
gagcgctactgcctggcccttggggaggaggagcgggccgagctgcagctcttctgtgcc
aggcggaagcaggaagccctgggacagggggtagcccgcctggtacttcccaagcttgaa
ggacacacctgtgagaagtgtagggagctgctgaagccaggggagtacggagtgtttgca
gcccgggcaggggaacagcgctgctggcaccagccttgctttgcctgccaggcctgtggc
caggccctgataaacctcatctacttctaccatgatggacaactctactgcggccgtcat
catgcagagttgctgcgcccgcgctgcccggcttgtgaccagctgatcttctcctggcgc
tgcaccgaggcggagggacagcgctggcatgagaaccacttctgttgccaggactgcgcc
gggcctctgggcgggggacgttatgccctgcctgggggaagcccctgctgccccagctgc
ttcgagaaccgctactcggatgcaggctcgagctgggccggggcactggaagggcaggca
ttccttggggagactggactcgaccgaactgaaggaagggaccaaacctcggtgaactct
gcaaccctctcccgaacactcctcgctgctgccggcggttccagcctgcaaactcagagg
gggctgcctggatccagtccccagcaggagaaccgacctggggacaaagcggaggcaccc
aaagggcaggagcaatgccgcctggagactattcgtgatcccaaggacacccctttctcc
acctgctcctcctcctctgactcggaacctgaaggatttttcttaggcgagcgccttccc
cagtcctggaagacccccggaagcctccaagcagaggacagcaacgcctctaagacgcac
tgcaccatgtgctag

KEGG   Homo sapiens (human): 4007
Entry
4007              CDS       T01001                                 
Symbol
PRICKLE3, LMO6, LOAM, Pk3
Name
(RefSeq) prickle planar cell polarity protein 3
  KO
K04511  prickle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    4007 (PRICKLE3)
SSDB
Motif
Pfam: PET LIM SR-25 Vasculin
Other DBs
NCBI-GeneID: 4007
NCBI-ProteinID: NP_006141
OMIM: 300111
HGNC: 6645
Ensembl: ENSG00000012211
Pharos: O43900(Tdark)
UniProt: O43900 B7Z5U0 B7Z8D2 A0A024QYW5
LinkDB
Position
X:complement(49174802..49186373)
AA seq 615 aa
MFARGSRRRRSGRAPPEAEDPDRGQPCNSCREQCPGFLLHGWRKICQHCKCPREEHAVHA
VPVDLERIMCRLISDFQRHSISDDDSGCASEEYAWVPPGLKPEQVYQFFSCLPEDKVPYV
NSPGEKYRIKQLLHQLPPHDSEAQYCTALEEEEKKELRAFSQQRKRENLGRGIVRIFPVT
ITGAICEECGKQIGGGDIAVFASRAGLGACWHPQCFVCTTCQELLVDLIYFYHVGKVYCG
RHHAECLRPRCQACDEIIFSPECTEAEGRHWHMDHFCCFECEASLGGQRYVMRQSRPHCC
ACYEARHAEYCDGCGEHIGLDQGQMAYEGQHWHASDRCFCCSRCGRALLGRPFLPRRGLI
FCSRACSLGSEPTAPGPSRRSWSAGPVTAPLAASTASFSAVKGASETTTKGTSTELAPAT
GPEEPSRFLRGAPHRHSMPELGLRSVPEPPPESPGQPNLRPDDSAFGRQSTPRVSFRDPL
VSEGGPRRTLSAPPAQRRRPRSPPPRAPSRRRHHHHNHHHHHNRHPSRRRHYQCDAGSGS
DSESCSSSPSSSSSESSEDDGFFLGERIPLPPHLCRPMPAQDTAMETFNSPSLSLPRDSR
AGMPRQARDKNCIVA
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgttcgcgcgtgggtcccggaggcgccgctccgggcgtgcgcctccagaggcagaggac
ccagaccggggccagccctgcaactcctgtagggagcagtgccctggcttcctgctccac
ggctggagaaagatctgccagcattgcaaatgcccgcgggaggagcatgcagtgcacgcg
gtgcctgtggacctggaacgcatcatgtgtcggctaatctcggacttccagcgccactcc
atctccgacgacgactcaggctgtgcatcggaggagtatgcctgggtgcccccaggcctt
aagccggagcaggtatatcaatttttcagctgcctcccagaggacaaggtcccctacgtc
aacagtcctggggagaaatacaggatcaagcagctgctgcaccagctgcccccacacgac
agtgaggcacagtactgcacagcactggaagaggaggaaaagaaagagctccgagccttt
agccagcagcggaagcgggagaatctggggcgtggcatcgtgcgcatcttcccggtgacc
atcactggggccatctgtgaggagtgcggaaagcagattggaggtggggacatcgcagtg
tttgccagccgtgcaggcctgggtgcctgctggcacccacagtgcttcgtgtgtaccacg
tgccaggaactgctggttgacctcatctacttctaccatgttggcaaggtctactgcggg
cgtcaccatgccgaatgcctgcgtccacgctgccaagcctgtgacgagatcatcttctcc
cctgagtgcacggaggctgagggccgccactggcacatggatcacttctgctgctttgag
tgtgaagcttcactaggagggcagcgctatgtcatgcgtcagagccgcccccactgctgc
gcctgctacgaggcccgccacgcggagtactgtgatggctgtggggagcacatcggcctg
gaccaaggccagatggcttacgagggccagcactggcatgcctcagaccgctgcttctgc
tgtagtcgctgtgggcgggccctgctgggccgcccattcctgccacgccgaggcctaatc
ttctgctctcgagcctgcagccttgggtccgagcccacagctccagggccgagccgccgc
agctggagtgccggccctgtcacagccccacttgcagcctccacagcctctttctctgct
gtgaagggggcatcagagaccaccaccaaaggcaccagcacagagttagcgccagctaca
ggccctgaggagccctcccgctttctgagaggggctccccaccgccactccatgccggaa
ctggggctccgcagtgtccccgagccgcccccagagtcccccggccagcctaacctgcgc
ccagatgatagtgccttcggtcgtcagagcaccccacgcgtcagcttccgcgaccctctg
gtgtctgaaggaggcccgcgccggaccctgagtgcacccccggcccagcgccgcaggcca
cgcagtcccccacccagggcccccagccgtcgccgccaccatcatcataatcaccatcac
catcacaaccgccacccaagcagacgtcgccactatcaatgtgacgcgggatcagggtca
gactcggaatcttgctccagctcgccctccagttccagttccgaatcatcagaggatgat
ggcttcttcctaggagagcgcatccctctgcccccgcatttgtgcaggcccatgcctgct
caggacactgcaatggagaccttcaactccccatctttatcgctccccagggactctcgc
gcagggatgcctcgtcaggcccgagacaagaactgcatcgtggcttga

DBGET integrated database retrieval system