KEGG   Homo sapiens (human): 150786
Entry
150786            CDS       T01001                                 
Symbol
RAB6D, RAB6CL, WTH3DI
Name
(RefSeq) RAB6D, member RAS oncogene family
  KO
K07895  Ras-related protein Rab-6C
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    150786 (RAB6D)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    150786 (RAB6D)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    150786 (RAB6D)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    150786 (RAB6D)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB RsgA_GTPase
Other DBs
NCBI-GeneID: 150786
NCBI-ProteinID: NP_001071105
HGNC: 30272
Ensembl: ENSG00000233087
UniProt: Q53S08
LinkDB
Position
2:complement(131360492..131364168)
AA seq 254 aa
MSAGGDFGNPLRKFKLVFLGEQSVAKTSLITRFRYDSFDNTYQAIIGIDFLSKTMYLEDG
TIGLRLWDTAGQERLRSLIPRYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTEGGSDVI
ITLVGNKTDLADKRQVSIEEGERKAKGLNVTFIETRAKAGYNVKQLFRRVAAALPGMEST
QDGSREDMSDIKLEKPQEQTVSEGGCSCYSPMSSSTLPQKPPYSFIDCSVNIGLNLFPSL
ITFCNSSLLPVSWR
NT seq 765 nt   +upstreamnt  +downstreamnt
atgtccgcgggcggagacttcgggaatccgctgaggaaattcaagctggtgttcctgggg
gagcaaagcgttgcaaagacatctttgatcaccagattcaggtatgacagttttgacaac
acctatcaggcaataattggcattgactttttatcaaaaactatgtacttggaggatgga
acaatcgggcttcggctgtgggatacggcgggtcaggaacgtctccgtagcctcattccc
aggtacatccgtgattctgctgcagctgtagtagtttacgatatcacaaatgttaactca
ttccagcaaactacaaagtggattgatgatgtcagaacagaaggaggaagtgatgttatc
atcacgctagtaggaaataaaacagatcttgctgacaagaggcaagtgtcaattgaggag
ggagagaggaaagccaaagggctgaatgttacgtttattgaaactagggcaaaagctgga
tacaatgtaaagcagctctttcgacgtgtagcagcagctttgccgggaatggaaagcaca
caggacggaagcagagaagacatgagtgacataaaactggaaaagcctcaggagcaaaca
gtcagcgaagggggttgttcctgctactctcccatgtcatcttcaacccttcctcagaag
cccccttactctttcattgactgcagtgtgaatattggcttgaaccttttcccttcatta
ataacgttttgcaattcatcattgctgcctgtctcgtggagatga

DBGET integrated database retrieval system