KEGG   Homo sapiens (human): 1511
Entry
1511              CDS       T01001                                 
Symbol
CTSG, CATG, CG
Name
(RefSeq) cathepsin G
  KO
K01319  cathepsin G [EC:3.4.21.20]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04142  Lysosome
hsa04613  Neutrophil extracellular trap formation
hsa04614  Renin-angiotensin system
hsa05146  Amoebiasis
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1511 (CTSG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    1511 (CTSG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    1511 (CTSG)
  09152 Endocrine system
   04614 Renin-angiotensin system
    1511 (CTSG)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    1511 (CTSG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    1511 (CTSG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1511 (CTSG)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1511 (CTSG)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.20  cathepsin G
     1511 (CTSG)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   1511 (CTSG)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Others
   1511 (CTSG)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 1511
NCBI-ProteinID: NP_001902
OMIM: 116830
HGNC: 2532
Ensembl: ENSG00000100448
Pharos: P08311(Tchem)
UniProt: P08311
Structure
LinkDB
Position
14:complement(24573518..24576250)
AA seq 255 aa
MQPLLLLLAFLLPTGAEAGEIIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVL
TAAHCWGSNINVTLGAHNIQRRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRR
NRNVNPVALPRAQEGLRPGTLCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYD
PRRQICVGDRRERKAAFKGDSGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRT
TMRSFKLLDQMETPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgcagccactcctgcttctgctggcctttctcctacccactggggctgaggcaggggag
atcatcggaggccgggagagcaggccccactcccgcccctacatggcgtatcttcagatc
cagagtccagcaggtcagagcagatgtggagggttcctggtgcgagaagactttgtgctg
acagcagctcattgctggggaagcaatataaatgtcaccctgggcgcccacaatatccag
agacgggaaaacacccagcaacacatcactgcgcgcagagccatccgccaccctcaatat
aatcagcggaccatccagaatgacatcatgttattgcagctgagcagaagagtcagacgg
aatcgaaacgtgaacccagtggctctgcctagagcccaggagggactgagacccgggacg
ctgtgcactgtggccggctggggcagggtcagcatgaggaggggaacagatacactccga
gaggtgcagctgagagtgcagagggataggcagtgcctccgcatcttcggttcctacgac
ccccgaaggcagatttgtgtgggggaccggcgggaacggaaggctgccttcaagggggat
tccggaggccccctgctgtgtaacaatgtggcccacggcatcgtctcctatggaaagtcg
tcaggggttcctccagaagtcttcaccagggtctcaagtttcctgccctggataaggaca
acaatgagaagcttcaaactgctggatcagatggagacccccctgtga

KEGG   Homo sapiens (human): 2147
Entry
2147              CDS       T01001                                 
Symbol
F2, PT, RPRGL2, THPH1
Name
(RefSeq) coagulation factor II, thrombin
  KO
K01313  coagulation factor II (thrombin) [EC:3.4.21.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
hsa04611  Platelet activation
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01315  Lectin pathway of coagulation activation
N01316  SARS-CoV-2 S/N to lectin pathway of coagulation activation
Disease
H00223  Inherited thrombophilia
H01254  Congenital prothrombin deficiency
Drug target
Argatroban (DG00163): D00181<JP/US>
Bivalirudin: D03136
Bivalirudin (DG02963): D11280<US>
Dabigatran (DG00164): D09707
Dabigatran etexilate (DG00164): D07082<JP/US> D07144
Desirudin: D03692
Efegatran sulfate: D03722
Lepirudin: D06880
Melagatran: D07143
Napsagatran: D03728
Thrombomodulin alfa: D06410<JP>
Ximelagatran: D01981
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    2147 (F2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2147 (F2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2147 (F2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    2147 (F2)
   04611 Platelet activation
    2147 (F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2147 (F2)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    2147 (F2)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    2147 (F2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    2147 (F2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2147 (F2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2147 (F2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.5  thrombin
     2147 (F2)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   2147 (F2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   2147 (F2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   2147 (F2)
SSDB
Motif
Pfam: Trypsin Kringle Thrombin_light Gla DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 2147
NCBI-ProteinID: NP_000497
OMIM: 176930
HGNC: 3535
Ensembl: ENSG00000180210
Pharos: P00734(Tclin)
CPD: C00752
UniProt: P00734
Structure
LinkDB
Position
11:46719213..46739506
AA seq 622 aa
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLEREC
VEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGTNYRGHV
NITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRQE
CSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVTTHGLPCLAWASA
QAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGYCDLNYCEEAVEEETG
DGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLEDKTERELLESYI
DGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPVAFSDYIHP
VCLPDRETAASLLQAGYKGRVTGWGNLKETWTANVGKGQPSVLQVVNLPIVERPVCKDST
RIRITDNMFCAGYKPDEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIQKVIDQFGE
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggcgcacgtccgaggcttgcagctgcctggctgcctggccctggctgccctgtgtagc
cttgtgcacagccagcatgtgttcctggctcctcagcaagcacggtcgctgctccagcgg
gtccggcgagccaacaccttcttggaggaggtgcgcaagggcaacctggagcgagagtgc
gtggaggagacgtgcagctacgaggaggccttcgaggctctggagtcctccacggctacg
gatgtgttctgggccaagtacacagcttgtgagacagcgaggacgcctcgagataagctt
gctgcatgtctggaaggtaactgtgctgagggtctgggtacgaactaccgagggcatgtg
aacatcacccggtcaggcattgagtgccagctatggaggagtcgctacccacataagcct
gaaatcaactccactacccatcctggggccgacctacaggagaatttctgccgcaacccc
gacagcagcaccacgggaccctggtgctacactacagaccccaccgtgaggaggcaggaa
tgcagcatccctgtctgtggccaggatcaagtcactgtagcgatgactccacgctccgaa
ggctccagtgtgaatctgtcacctccattggagcagtgtgtccctgatcgggggcagcag
taccaggggcgcctggcggtgaccacacatgggctcccctgcctggcctgggccagcgca
caggccaaggccctgagcaagcaccaggacttcaactcagctgtgcagctggtggagaac
ttctgccgcaacccagacggggatgaggagggcgtgtggtgctatgtggccgggaagcct
ggcgactttgggtactgcgacctcaactattgtgaggaggccgtggaggaggagacagga
gatgggctggatgaggactcagacagggccatcgaagggcgtaccgccaccagtgagtac
cagactttcttcaatccgaggacctttggctcgggagaggcagactgtgggctgcgacct
ctgttcgagaagaagtcgctggaggacaaaaccgaaagagagctcctggaatcctacatc
gacgggcgcattgtggagggctcggatgcagagatcggcatgtcaccttggcaggtgatg
cttttccggaagagtccccaggagctgctgtgtggggccagcctcatcagtgaccgctgg
gtcctcaccgccgcccactgcctcctgtacccgccctgggacaagaacttcaccgagaat
gaccttctggtgcgcattggcaagcactcccgcaccaggtacgagcgaaacattgaaaag
atatccatgttggaaaagatctacatccaccccaggtacaactggcgggagaacctggac
cgggacattgccctgatgaagctgaagaagcctgttgccttcagtgactacattcaccct
gtgtgtctgcccgacagggagacggcagccagcttgctccaggctggatacaaggggcgg
gtgacaggctggggcaacctgaaggagacgtggacagccaacgttggtaaggggcagccc
agtgtcctgcaggtggtgaacctgcccattgtggagcggccggtctgcaaggactccacc
cggatccgcatcactgacaacatgttctgtgctggttacaagcctgatgaagggaaacga
ggggatgcctgtgaaggtgacagtgggggaccctttgtcatgaagagcccctttaacaac
cgctggtatcaaatgggcatcgtctcatggggtgaaggctgtgaccgggatgggaaatat
ggcttctacacacatgtgttccgcctgaagaagtggatacagaaggtcattgatcagttt
ggagagtag

KEGG   Homo sapiens (human): 3001
Entry
3001              CDS       T01001                                 
Symbol
GZMA, CTLA3, HFSP
Name
(RefSeq) granzyme A
  KO
K01352  granzyme A [EC:3.4.21.78]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3001 (GZMA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    3001 (GZMA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.78  granzyme A
     3001 (GZMA)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   3001 (GZMA)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 3001
NCBI-ProteinID: NP_006135
OMIM: 140050
HGNC: 4708
Ensembl: ENSG00000145649
Pharos: P12544(Tbio)
UniProt: P12544
Structure
LinkDB
Position
5:55102646..55110252
AA seq 262 aa
MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIA
KDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQL
MEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCN
DRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGP
GVYILLSKKHLNWIIMTIKGAV
NT seq 789 nt   +upstreamnt  +downstreamnt
atgaggaactcctatagatttctggcatcctctctctcagttgtcgtttctctcctgcta
attcctgaagatgtctgtgaaaaaattattggaggaaatgaagtaactcctcattcaaga
ccctacatggtcctacttagtcttgacagaaaaaccatctgtgctggggctttgattgca
aaagactgggtgttgactgcagctcactgtaacttgaacaaaaggtcccaggtcattctt
ggggctcactcaataaccagggaagagccaacaaaacagataatgcttgttaagaaagag
tttccctatccatgctatgacccagccacacgcgaaggtgaccttaaacttttacagctg
atggaaaaagcaaaaattaacaaatatgtgactatccttcatctacctaaaaagggggac
gatgtgaaaccaggaaccatgtgccaagttgcagggtggggcaggactcacaatagtgca
tcttggtccgatactctgagagaagtcaatatcaccatcatagacagaaaagtctgcaat
gatcgaaatcactataattttaaccctgtgattggaatgaatatggtttgtgctggaagc
ctccgaggtggaagagactcgtgcaatggagattctggaagccctttgttgtgcgagggt
gttttccgaggggtcacttcctttggccttgaaaataaatgcggagaccctcgtgggcct
ggtgtctatattcttctctcaaagaaacacctcaactggataattatgactatcaaggga
gcagtttaa

KEGG   Homo sapiens (human): 5340
Entry
5340              CDS       T01001                                 
Symbol
PLG, HAE4
Name
(RefSeq) plasminogen
  KO
K01315  plasminogen [EC:3.4.21.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
hsa05150  Staphylococcus aureus infection
hsa05164  Influenza A
Disease
H01006  Hereditary angioedema
H01206  Plasminogen deficiency
Drug target
Aminocaproic acid: D00160<US>
Aminomethylbenzoic acid: D07568
Plasminogen: D12149
Tranexamic acid: D01136<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5340 (PLG)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    5340 (PLG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    5340 (PLG)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    5340 (PLG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5340 (PLG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5340 (PLG)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.7  plasmin
     5340 (PLG)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   5340 (PLG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5340 (PLG)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 Trypsin_2 DUF1986 DUF3719
Other DBs
NCBI-GeneID: 5340
NCBI-ProteinID: NP_000292
OMIM: 173350
HGNC: 9071
Ensembl: ENSG00000122194
Pharos: P00747(Tclin)
UniProt: P00747
Structure
LinkDB
Position
6:160702193..160754097
AA seq 810 aa
MEHKEVVLLLLLFLKSGQGEPLDDYVNTQGASLFSVTKKQLGAGSIEECAAKCEEDEEFT
CRAFQYHSKEQQCVIMAENRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKN
GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILE
CEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRE
LRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWS
AQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTE
QLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPVVLLPDVETPSEED
CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRT
RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLE
PTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQ
LPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVTSW
GLGCARPNKPGVYVRVSRFVTWIEGVMRNN
NT seq 2433 nt   +upstreamnt  +downstreamnt
atggaacataaggaagtggttcttctacttcttttatttctgaaatcaggtcaaggagag
cctctggatgactatgtgaatacccagggggcttcactgttcagtgtcactaagaagcag
ctgggagcaggaagtatagaagaatgtgcagcaaaatgtgaggaggacgaagaattcacc
tgcagggcattccaatatcacagtaaagagcaacaatgtgtgataatggctgaaaacagg
aagtcctccataatcattaggatgagagatgtagttttatttgaaaagaaagtgtatctc
tcagagtgcaagactgggaatggaaagaactacagagggacgatgtccaaaacaaaaaat
ggcatcacctgtcaaaaatggagttccacttctccccacagacctagattctcacctgct
acacacccctcagagggactggaggagaactactgcaggaatccagacaacgatccgcag
gggccctggtgctatactactgatccagaaaagagatatgactactgcgacattcttgag
tgtgaagaggaatgtatgcattgcagtggagaaaactatgacggcaaaatttccaagacc
atgtctggactggaatgccaggcctgggactctcagagcccacacgctcatggatacatt
ccttccaaatttccaaacaagaacctgaagaagaattactgtcgtaaccccgatagggag
ctgcggccttggtgtttcaccaccgaccccaacaagcgctgggaactttgtgacatcccc
cgctgcacaacacctccaccatcttctggtcccacctaccagtgtctgaagggaacaggt
gaaaactatcgcgggaatgtggctgttaccgtgtccgggcacacctgtcagcactggagt
gcacagacccctcacacacataacaggacaccagaaaacttcccctgcaaaaatttggat
gaaaactactgccgcaatcctgacggaaaaagggccccatggtgccatacaaccaacagc
caagtgcggtgggagtactgtaagataccgtcctgtgactcctccccagtatccacggaa
caattggctcccacagcaccacctgagctaacccctgtggtccaggactgctaccatggt
gatggacagagctaccgaggcacatcctccaccaccaccacaggaaagaagtgtcagtct
tggtcatctatgacaccacaccggcaccagaagaccccagaaaactacccaaatgctggc
ctgacaatgaactactgcaggaatccagatgccgataaaggcccctggtgttttaccaca
gaccccagcgtcaggtgggagtactgcaacctgaaaaaatgctcaggaacagaagcgagt
gttgtagcacctccgcctgttgtcctgcttccagatgtagagactccttccgaagaagac
tgtatgtttgggaatgggaaaggataccgaggcaagagggcgaccactgttactgggacg
ccatgccaggactgggctgcccaggagccccatagacacagcattttcactccagagaca
aatccacgggcgggtctggaaaaaaattactgccgtaaccctgatggtgatgtaggtggt
ccctggtgctacacgacaaatccaagaaaactttacgactactgtgatgtccctcagtgt
gcggccccttcatttgattgtgggaagcctcaagtggagccgaagaaatgtcctggaagg
gttgtaggggggtgtgtggcccacccacattcctggccctggcaagtcagtcttagaaca
aggtttggaatgcacttctgtggaggcaccttgatatccccagagtgggtgttgactgct
gcccactgcttggagaagtccccaaggccttcatcctacaaggtcatcctgggtgcacac
caagaagtgaatctcgaaccgcatgttcaggaaatagaagtgtctaggctgttcttggag
cccacacgaaaagatattgccttgctaaagctaagcagtcctgccgtcatcactgacaaa
gtaatcccagcttgtctgccatccccaaattatgtggtcgctgaccggaccgaatgtttc
atcactggctggggagaaacccaaggtacttttggagctggccttctcaaggaagcccag
ctccctgtgattgagaataaagtgtgcaatcgctatgagtttctgaatggaagagtccaa
tccaccgaactctgtgctgggcatttggccggaggcactgacagttgccagggtgacagt
ggaggtcctctggtttgcttcgagaaggacaaatacattttacaaggagtcacttcttgg
ggtcttggctgtgcacgccccaataagcctggtgtctatgttcgtgtttcaaggtttgtt
acttggattgagggagtgatgagaaataattaa

KEGG   Homo sapiens (human): 5644
Entry
5644              CDS       T01001                                 
Symbol
PRSS1, TRP1, TRY1, TRY4, TRYP1
Name
(RefSeq) serine protease 1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
hsa05164  Influenza A
Disease
H00933  Hereditary pancreatitis
Drug target
Ulinastatin: D05183<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5644 (PRSS1)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    5644 (PRSS1)
   04974 Protein digestion and absorption
    5644 (PRSS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    5644 (PRSS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5644 (PRSS1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5644 (PRSS1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     5644 (PRSS1)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   5644 (PRSS1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5644 (PRSS1)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 5644
NCBI-ProteinID: NP_002760
OMIM: 276000
HGNC: 9475
Ensembl: ENSG00000204983
Pharos: P07477(Tclin)
UniProt: P07477
Structure
LinkDB
Position
7:142749472..142753072
AA seq 247 aa
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaatccactcctgatccttacctttgtggcagctgctcttgctgccccctttgatgat
gatgacaagatcgttgggggctacaactgtgaggagaattctgtcccctaccaggtgtcc
ctgaattctggctaccacttctgtggtggctccctcatcaacgaacagtgggtggtatca
gcaggccactgctacaagtcccgcatccaggtgagactgggagagcacaacatcgaagtc
ctggaggggaatgagcagttcatcaatgcagccaagatcatccgccacccccaatacgac
aggaagactctgaacaatgacatcatgttaatcaagctctcctcacgtgcagtaatcaac
gcccgcgtgtccaccatctctctgcccaccgcccctccagccactggcacgaagtgcctc
atctctggctggggcaacactgcgagctctggcgccgactacccagacgagctgcagtgc
ctggatgctcctgtgctgagccaggctaagtgtgaagcctcctaccctggaaagattacc
agcaacatgttctgtgtgggcttccttgagggaggcaaggattcatgtcagggtgattct
ggtggccctgtggtctgcaatggacagctccaaggagttgtctcctggggtgatggctgt
gcccagaagaacaagcctggagtctacaccaaggtctacaactatgtgaaatggattaag
aacaccatagctgccaatagctaa

KEGG   Homo sapiens (human): 5645
Entry
5645              CDS       T01001                                 
Symbol
PRSS2, TRY2, TRY8, TRYP2
Name
(RefSeq) serine protease 2
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
hsa05164  Influenza A
Disease
H00933  Hereditary pancreatitis
Drug target
Ulinastatin: D05183<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5645 (PRSS2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    5645 (PRSS2)
   04974 Protein digestion and absorption
    5645 (PRSS2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    5645 (PRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5645 (PRSS2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5645 (PRSS2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     5645 (PRSS2)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   5645 (PRSS2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5645 (PRSS2)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 5645
NCBI-ProteinID: NP_002761
OMIM: 601564
HGNC: 9483
Ensembl: ENSG00000275896
Pharos: P07478(Tchem)
UniProt: P07478 Q5NV56 Q6PK75
LinkDB
Position
7:142770970..142774560
AA seq 247 aa
MNLLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVIN
SRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGKIT
NNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIK
DTIAANS
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaatctacttctgatccttacctttgttgcagctgctgttgctgccccctttgatgat
gatgacaagatcgttgggggctacatctgtgaggagaattctgtcccctaccaggtgtcc
ttgaattctggctaccacttctgcggtggctccctcatcagcgaacagtgggtggtgtca
gcaggtcactgctacaagtcccgcatccaggtgagactgggagagcacaacatcgaagtc
ctggaggggaatgaacagttcatcaatgcggccaagatcatccgccaccccaaatacaac
agccggactctggacaatgacatcctgctgatcaagctctcctcacctgccgtcatcaat
tcccgcgtgtccgccatctctctgcccactgcccctccagctgctggcaccgagtccctc
atctccggctggggcaacactctgagttctggtgccgactacccagacgagctgcagtgc
ctggatgctcctgtgctgagccaggctgagtgtgaagcctcctaccctggaaagattacc
aacaacatgttctgtgtgggcttcctcgagggaggcaaggattcctgccagggtgattct
ggtggccctgtggtctccaatggagagctccaaggaattgtctcctggggctatggctgt
gcccagaagaacaggcctggagtctacaccaaggtctacaactatgtggactggattaag
gacaccatagctgccaacagctaa

KEGG   Homo sapiens (human): 5646
Entry
5646              CDS       T01001                                 
Symbol
PRSS3, MTG, PRSS4, T9, TRY3, TRY4
Name
(RefSeq) serine protease 3
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
hsa05164  Influenza A
Drug target
Ulinastatin: D05183<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    5646 (PRSS3)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    5646 (PRSS3)
   04974 Protein digestion and absorption
    5646 (PRSS3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    5646 (PRSS3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5646 (PRSS3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5646 (PRSS3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     5646 (PRSS3)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   5646 (PRSS3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5646 (PRSS3)
SSDB
Motif
Pfam: Trypsin DUF1986
Other DBs
NCBI-GeneID: 5646
NCBI-ProteinID: NP_001184026
OMIM: 613578
HGNC: 9486
Ensembl: ENSG00000010438
Pharos: P35030(Tchem)
UniProt: P35030 Q7Z5F4
Structure
LinkDB
Position
9:33750679..33799231
AA seq 261 aa
MHMRETSGFTLKKGRSAPLVFHPPDALIAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSH
FCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDN
DIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVL
TQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRP
GVYTKVYNYVDWIKDTIAANS
NT seq 786 nt   +upstreamnt  +downstreamnt
atgcacatgagagagacaagtggcttcacattgaagaaggggaggagtgcgccattggtt
ttccatcctccagatgcactgattgctgtcccctttgacgatgatgacaagattgttggg
ggctacacctgtgaggagaattctctcccctaccaggtgtccctgaattctggctcccac
ttctgcggtggctccctcatcagcgaacagtgggtggtatcagcagctcactgctacaag
acccgcatccaggtgagactgggagagcacaacatcaaagtcctggaggggaatgagcag
ttcatcaatgcggccaagatcatccgccaccctaaatacaacagggacactctggacaat
gacatcatgctgatcaaactctcctcacctgccgtcatcaatgcccgcgtgtccaccatc
tctctgcccaccacccctccagctgctggcactgagtgcctcatctccggctggggcaac
actctgagctttggtgctgactacccagacgagctgaagtgcctggatgctccggtgctg
acccaggctgagtgtaaagcctcctaccctggaaagattaccaacagcatgttctgtgtg
ggcttccttgagggaggcaaggattcctgccagcgtgactctggtggccctgtggtctgc
aacggacagctccaaggagttgtctcctggggccatggctgtgcctggaagaacaggcct
ggagtctacaccaaggtctacaactatgtggactggattaaggacaccatcgctgccaac
agctaa

DBGET integrated database retrieval system