KEGG   Homo sapiens (human): 165324
Entry
165324            CDS       T01001                                 
Symbol
UBXN2A, UBXD4
Name
(RefSeq) UBX domain protein 2A
  KO
K24349  UBX domain-containing protein 2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    165324 (UBXN2A)
SSDB
Motif
Pfam: SEP UBX Spt20
Other DBs
NCBI-GeneID: 165324
NCBI-ProteinID: NP_859064
HGNC: 27265
Ensembl: ENSG00000173960
Vega: OTTHUMG00000125497
Pharos: P68543(Tdark)
UniProt: P68543
LinkDB
Position
2:23927278..24004909
AA seq 259 aa
MKDVDNLKSIKEEWVCETGSDNQPLGNNQQSNCEYFVDSLFEEAQKVSSKCVSPAEQKKQ
VDVNIKLWKNGFTVNDDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVEDKKN
EICLSTKPVFQPFSGQGHRLGSATPKIVSKAKNIEVENKNNLSAVPLNNLEPITNIQIWL
ANGKRIVQKFNITHRVSHIKDFIEKYQGSQRSPPFSLATALPVLRLLDETLTLEEADLQN
AVIIQRLQKTASFRELSEH
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaaagacgtagataacctcaaaagtataaaagaagaatgggtttgtgaaacaggatct
gataatcaacctcttggtaataatcaacaatcaaattgtgaatattttgttgatagcctt
tttgaggaagctcagaaggttagttccaaatgtgtgtctcccgctgaacagaagaaacag
gtagatgtaaatataaaattatggaaaaacggattcaccgtcaacgacgatttcagaagt
tattccgatggtgccagtcagcagtttttgaactccatcaaaaagggggaattaccttca
gaattacagggaatttttgataaagaagaggtggacgttaaagttgaagacaagaaaaat
gaaatatgtttgtctacgaagcctgtgttccagcccttttcaggacagggtcacagacta
ggaagtgccacaccaaaaattgtttctaaagcaaagaatattgaagttgaaaataaaaat
aatttgtctgctgttccactgaacaacttggaacccattactaatatacagatctggttg
gccaatggaaaaaggattgtccagaaatttaacattactcatagagtaagccatatcaaa
gacttcattgaaaaataccaaggatctcaaagaagtcctccgttttccctggcaacagct
cttcctgtcctcaggttgctagatgagacactcacactggaagaagcagatttacagaat
gctgtcatcattcagagactccaaaaaactgcatcttttagagaactttcagagcactga

KEGG   Homo sapiens (human): 23190
Entry
23190             CDS       T01001                                 
Symbol
UBXN4, UBXD2, UBXDC1, erasin
Name
(RefSeq) UBX domain protein 4
  KO
K24348  UBX domain-containing protein 1/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    23190 (UBXN4)
SSDB
Motif
Pfam: UBX
Other DBs
NCBI-GeneID: 23190
NCBI-ProteinID: NP_055422
OMIM: 611216
HGNC: 14860
Ensembl: ENSG00000144224
Vega: OTTHUMG00000153577
Pharos: Q92575(Tdark)
UniProt: Q92575
Structure
LinkDB
Position
2:135741855..135785056
AA seq 508 aa
MLWFQGAIPAAIATAKRSGAVFVVFVAGDDEQSTQMAASWEDDKVTEASSNSFVAIKIDT
KSEACLQFSQIYPVVCVPSSFFIGDSGIPLEVIAGSVSADELVTRIHKVRQMHLLKSETS
VANGSQSESSVSTPSASFEPNNTCENSQSRNAELCEIPPTSDTKSDTATGGESAGHATSS
QEPSGCSDQRPAEDLNIRVERLTKKLEERREEKRKEEEQREIKKEIERRKTGKEMLDYKR
KQEEELTKRMLEERNREKAEDRAARERIKQQIALDRAERAARFAKTKEEVEAAKAAALLA
KQAEMEVKRESYARERSTVARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGNF
SLATMFPRREFTKEDYKKKLLDLELAPSASVVLLPAGRPTASIVHSSSGDIWTLLGTVLY
PFLAIWRLISNFLFSNPPPTQTSVRVTSSEPPNPASSSKSEKREPVRKRVLEKRGDDFKK
EGKIYRLRTQDDGEDENNTWNGNSTQQM
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgctgtggttccagggcgccattccggccgccatcgcgacggccaaaaggagcggcgcg
gtcttcgtggtgttcgtggcaggtgatgatgaacagtctacacagatggctgcaagttgg
gaagatgataaagttacagaagcatcttcaaacagttttgttgctattaaaatcgatacc
aaaagtgaagcctgcctacagttttcacaaatctatcctgtagtgtgtgttccatccagt
ttctttattggagacagtggaattcccttggaagtaatagcaggaagtgtttctgcagat
gaacttgttacaagaattcacaaggtccgacagatgcatttgctaaaaagtgaaacatca
gtagcaaatggcagtcagtcagaaagttcagtgtctactccatctgcgtcatttgaacct
aacaacacttgtgaaaactctcagtccagaaatgcagagctttgtgagataccacccact
tctgatacaaagtcagatactgcaacaggaggagaaagtgcaggccatgccacttcctct
caggagcctagtggatgctcagatcagagacctgcagaggacctcaacatccgagtggaa
agactaacaaaaaaacttgaagaaaggagagaagagaaaagaaaagaggaagaacagaga
gaaattaagaaggaaattgagaggagaaaaactggaaaagaaatgttggattataaaaga
aaacaagaagaagaattaacaaaaagaatgctggaggaaagaaacagagagaaagcagaa
gatagggcagctcgagaacgtataaaacagcagattgcattggaccgtgcagagagagct
gctcgttttgcaaagacaaaggaagaagtagaggctgccaaagctgctgccttgctagca
aaacaggcagaaatggaagtcaagagggaatcttatgcaagagaaagaagcactgttgca
agaattcaattccgtcttcctgatggttcttcctttacaaatcagttcccttctgatgct
cctctagaagaggcaaggcagtttgctgcacagactgttggcaacacttacggtaatttt
tcgttagcaaccatgtttcccaggagggaatttaccaaagaagattataaaaagaagtta
ctggatttggaacttgccccaagcgcttcggtggtactgttgccagcaggaagaccaact
gcatccattgtacactcttccagcggagacatttggaccttgttgggaacagtgctttat
ccattccttgccatctggagattaattagcaatttcttgtttagtaatccgcctcccaca
cagacttcagtgagagtaacatcgtcagaacccccaaaccctgcatcatctagcaaatca
gaaaaaagggaaccagtgagaaaaagagtgctggaaaaacgtggagacgactttaaaaag
gaggggaaaatttatagattaaggactcaagatgatggtgaagatgaaaacaacacttgg
aatggaaattccactcaacagatgtag

KEGG   Homo sapiens (human): 51035
Entry
51035             CDS       T01001                                 
Symbol
UBXN1, 2B28, SAKS1, UBXD10
Name
(RefSeq) UBX domain protein 1
  KO
K24348  UBX domain-containing protein 1/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    51035 (UBXN1)
SSDB
Motif
Pfam: UBX UBA Selenoprotein_S
Other DBs
NCBI-GeneID: 51035
NCBI-ProteinID: NP_001273006
OMIM: 616378
HGNC: 18402
Ensembl: ENSG00000162191
Vega: OTTHUMG00000167580
Pharos: Q04323(Tbio)
UniProt: Q04323 A0A024R598
LinkDB
Position
11:complement(62676500..62679073)
AA seq 297 aa
MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHIL
GREPTSSEQGGLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALER
ERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYG
GSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVR
LYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAKKCPS
NT seq 894 nt   +upstreamnt  +downstreamnt
atggcggagctgacggctcttgagagtctcatcgagatgggcttccccaggggacgcgcg
gagaaggctctggccctcacagggaaccagggcatcgaggctgcgatggactggctgatg
gagcacgaagacgaccccgatgtggacgagcctttagagactccccttggacatatcctg
ggacgggagcccacttcctcagagcaaggcggccttgaaggatctggttctgctgccgga
gaaggcaaacccgctttgagtgaagaggaaagacaggaacaaactaagaggatgttggag
ctggtggcccagaagcagcgggagcgtgaagaaagagaggaacgggaggcattggaacgg
gaacggcagcgcaggagacaagggcaagagttgtcagcagcacgacagcggctacaggaa
gatgagatgcgccgggctgctgaggagaggcggagggaaaaggccgaggagttagcagcc
agacaaagagttagagaaaagatcgagagggacaaagcagagagagccaagaagtatggt
ggcagtgtgggctctcagccacccccagtggcaccagagccaggtcctgttccctcttct
cccagccaggagcctcccaccaagcgggagtatgaccagtgtcgcatacaggtcaggctg
ccagatgggacctcactgacccagacgttccgggcccgggaacagctggcagctgtgagg
ctctatgtggagctccaccgtggggaggaactaggtgggggccaggaccctgtgcaattg
ctcagtggcttccccagacgggccttctcagaagctgacatggagcggcctctgcaggag
ctgggactcgtgccttctgctgttctcattgtggccaagaaatgtcccagctga

KEGG   Homo sapiens (human): 55968
Entry
55968             CDS       T01001                                 
Symbol
NSFL1C, P47, UBX1, UBXD10, UBXN2C, dJ776F14.1
Name
(RefSeq) NSFL1 cofactor
  KO
K14012  UBX domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    55968 (NSFL1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55968 (NSFL1C)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Others
    55968 (NSFL1C)
SSDB
Motif
Pfam: SEP UBX UBA_4 Spt20 TAP_C
Other DBs
NCBI-GeneID: 55968
NCBI-ProteinID: NP_057227
OMIM: 606610
HGNC: 15912
Ensembl: ENSG00000088833
Vega: OTTHUMG00000031665
Pharos: Q9UNZ2(Tbio)
UniProt: Q9UNZ2 Q53FE8
Structure
LinkDB
Position
20:complement(1442166..1466849)
AA seq 370 aa
MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSS
VSRGTAPSDNRVTSFRDLIHDQDEDEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVD
DLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQDV
HVVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRD
EDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENEAKASSSILIDESEPTTNIQI
RLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELADESQTLKEANL
LNAVIVQRLT
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggcggcggagcgacaggaggcgctgagggagttcgtggcggtgacgggcgccgaggag
gaccgggcccgcttctttctcgagtcggccggctgggacttgcagatcgcgctagcgagc
ttttatgaggacggaggggatgaagacattgtgaccatttcgcaggcaacccccagttca
gtgtccagaggcacagcccccagtgataatagagtgacatccttcagagacctcattcat
gaccaagatgaagatgaggaggaagaggaaggccagaggttttatgctgggggctcagag
agaagtggacagcagattgttggccctcccaggaagaaaagtcccaacgagctggtggat
gatctctttaaaggtgccaaagagcatggagctgtagctgtggagcgagtgaccaagagc
cctggagagaccagtaaaccgagaccatttgcaggaggtggctaccgccttggggcagca
ccagaggaagagtctgcctatgtggcaggagaaaagaggcagcattccagccaagatgtt
catgtagtattgaaactctggaagagtggattcagcctggataatggagaactcagaagc
taccaagacccatccaatgcccagtttctggagtctatccgcagaggggaggtgccagca
gagcttcggaggctagctcacggtggacaggtgaacttggatatggaggaccatcgggac
gaggactttgtgaagcccaaaggagccttcaaagccttcactggcgagggtcagaaactg
ggcagcactgccccccaggtgttgagtaccagctctccagcccaacaggcagaaaatgaa
gccaaagccagctcttccatcttaatcgacgaatcagagcctaccacaaacatccaaatt
cggcttgcagacggcgggaggctggtgcagaaatttaaccacagccacaggatcagcgac
atccgactcttcatcgtggatgcccggccagccatggctgccaccagctttatcctcatg
actactttcccgaacaaagagctggctgatgagagccagaccctgaaggaagccaacctg
ctcaatgctgtcatcgtgcagcggttaacataa

KEGG   Homo sapiens (human): 7993
Entry
7993              CDS       T01001                                 
Symbol
UBXN8, D8S2298E, REP8, UBXD6
Name
(RefSeq) UBX domain protein 8
  KO
K24351  UBX domain-containing protein 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7993 (UBXN8)
SSDB
Motif
Pfam: UBX SDF EMC3_TMCO1
Other DBs
NCBI-GeneID: 7993
NCBI-ProteinID: NP_005662
OMIM: 602155
HGNC: 30307
Ensembl: ENSG00000104691
Vega: OTTHUMG00000163851
Pharos: O00124(Tdark)
UniProt: O00124
LinkDB
Position
8:30729135..30767006
AA seq 270 aa
MASRGVVGIFFLSAVPLVCLELRRGIPDIGIKDFLLLCGRILLLLALLTLTISVTTSWLN
SFKSPQVYLKEEEEKNEKRQKLVRKKQQEAQGEKASRYIENVLKPHQEMKLRKLEERFYQ
MTGEAWKLSSGHKLGGDEGTSQTSFETSNREAAKSQNLPKPLTEFPSPAEQPTCKEIPDL
PEEPSQTAEEVVTVALRCPSGNVLRRRFLKSYSSQVLFDWMTRIGYHISLYSLSTSFPRR
PLAVEGGQSLEDIGITVDTVLILEEKEQTN
NT seq 813 nt   +upstreamnt  +downstreamnt
atggcttcacgtggggttgttggcattttcttcctctctgctgtcccccttgtgtgtctg
gagctccggcgtgggatcccggatataggaatcaaggattttcttttgctttgtggccgg
attttgctactgcttgctcttcttactttaactatttctgtgactacctcatggcttaac
tcatttaaatctccccaagtttatctgaaggaagaagaagaaaagaatgagaaaagacaa
aaacttgtgagaaaaaaacaacaagaagcacaaggagagaaggccagcagatacatagag
aatgttttaaaacctcaccaggaaatgaaattgagaaaactggaggagcgcttttatcaa
atgacgggtgaagcctggaaattaagcagtggtcacaaacttgggggtgatgaaggtaca
agtcagacatcttttgaaacatcaaacagagaagcagcaaagagccagaacttgcctaaa
cctttaactgaatttccgtctcctgctgaacagcccacatgcaaggagattcctgattta
cctgaagaaccttctcaaacagcagaagaagtagttactgttgctctccgatgtcccagt
gggaatgtcctgaggagaaggtttttgaagtcctacagctcacaggtcttatttgactgg
atgacgagaattgggtaccacatatctctatacagcctttctacttcctttcccagacgg
cctctggcagtggagggaggccagtcgctggaggacataggaataactgtggacactgta
ctcatcctggaggagaaggagcagaccaactag

KEGG   Homo sapiens (human): 80700
Entry
80700             CDS       T01001                                 
Symbol
UBXN6, UBXD1, UBXDC2
Name
(RefSeq) UBX domain protein 6
  KO
K14011  UBX domain-containing protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    80700 (UBXN6)
SSDB
Motif
Pfam: PUB UBX
Other DBs
NCBI-GeneID: 80700
NCBI-ProteinID: NP_079517
OMIM: 611946
HGNC: 14928
Ensembl: ENSG00000167671
Vega: OTTHUMG00000181954
Pharos: Q9BZV1(Tbio)
UniProt: Q9BZV1
Structure
LinkDB
Position
19:complement(4445006..4457879)
AA seq 441 aa
MKKFFQEFKADIKFKSAGPGQKLKESVGEKAHKEKPNQPAPRPPRQGPTNEAQMAAAAAL
ARLEQKQSRAWGPTSQDTIRNQVRKELQAEATVSGSPEAPGTNVVSEPREEGSAHLAVPG
VYFTCPLTGATLRKDQRDACIKEAILLHFSTDPVAASIMKIYTFNKDQDRVKLGVDTIAK
YLDNIHLHPEEEKYRKIKLQNKVFQERINCLEGTHEFFEAIGFQKVLLPAQDQEDPEEFY
VLSETTLAQPQSLERHKEQLLAAEPVRAKLDRQRRVFQPSPLASQFELPGDFFNLTAEEI
KREQRLRSEAVERLSVLRTKAMREKEEQRGLRKYNYTLLRVRLPDGCLLQGTFYARERLG
AVYGFVREALQSDWLPFELLASGGQKLSEDENLALNECGLVPSALLTFSWDMAVLEDIKA
AGAEPDSILKPELLSAIEKLL
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgaagaaattctttcaggagttcaaggccgacatcaagttcaagagcgcgggacccggt
cagaagctcaaagagtccgtgggggaaaaggcccacaaagagaagcccaaccagccagcc
cccaggccgccccgccagggacccaccaatgaggcacagatggcagccgctgccgcccta
gcccggctggagcagaagcagtcccgggcctggggccccacatcgcaggacaccatccga
aaccaggtgagaaaggaacttcaagccgaagccaccgtcagcgggagccccgaggcccca
gggaccaacgtggtatctgagcccagagaggaaggctctgcccacctggctgtgcctggc
gtgtacttcacctgtccgctcactggggccaccctgaggaaggaccagcgggacgcctgc
atcaaggaggccattctcttgcacttctccaccgacccagtggccgcctccatcatgaag
atctacacgttcaacaaagaccaggaccgggtgaagctgggtgtggacaccattgccaag
tacctggacaacatccacctgcaccccgaggaggagaagtaccggaagatcaagctgcag
aacaaggtgtttcaggagcgcattaactgcctggaagggacccacgagttttttgaggcc
attgggttccagaaggtgttgcttcccgcccaggatcaggaggaccccgaggagttctac
gtgctgagcgagaccaccttggcccagccccagagcctggagaggcacaaggaacagctg
ctggctgcggagcccgtgcgcgccaagctggacaggcagcgccgcgtcttccagccctcg
cccctggcctcgcagttcgaactgcctggggacttcttcaacctcacagcagaggagatc
aagcgggagcagaggctcaggtccgaggcggtggagcggctgagcgtgctgcggaccaag
gccatgcgggagaaggaggagcagcgggggctgcgcaagtacaactacacgctgctgcgc
gtgcgcctccccgatggctgcctcctgcagggcactttctacgctcgggagcggctgggg
gcggtgtacgggttcgtccgggaggccctgcagagcgactggctgccttttgagctgctg
gcctcgggagggcagaagctgtccgaggacgagaacctggccttgaacgagtgcgggctg
gtgccctctgccctcctgaccttctcgtgggacatggctgtgctggaggacatcaaggcc
gcgggggccgagccggactccatcctgaaacccgagctcctgtcagccatcgagaagctc
ttgtga

DBGET integrated database retrieval system