KEGG   Homo sapiens (human): 1950
Entry
1950              CDS       T01001                                 
Symbol
EGF, HOMG4, URG
Name
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04540  Gap junction
hsa04630  JAK-STAT signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05210  Colorectal cancer
hsa05212  Pancreatic cancer
hsa05213  Endometrial cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05226  Gastric cancer
hsa05231  Choline metabolism in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06114  PI3K signaling (viruses)
nt06120  Calcium signaling (viruses and bacteria)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06170  Influenza A virus (IAV)
nt06210  ERK signaling
nt06213  Other RAS signaling
nt06214  PI3K signaling
nt06219  JAK-STAT signaling
nt06220  Calcium signaling
nt06227  Nuclear receptor signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06262  Pancreatic cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06266  Non-small cell lung cancer
nt06268  Melanoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06273  Glioma
nt06274  Thyroid cancer
nt06276  Chronic myeloid leukemia
  Element
N00001  EGF-EGFR-RAS-ERK signaling pathway
N00021  EGF-ERBB2-RAS-ERK signaling pathway
N00022  ERBB2-overexpression to RAS-ERK signaling pathway
N00023  EGF-EGFR-PLCG-ERK signaling pathway
N00026  EGF-EGFR-PLCG-CAMK signaling pathway
N00030  EGF-EGFR-RAS-PI3K signaling pathway
N00033  EGF-EGFR-PI3K signaling pathway
N00034  ERBB2-overexpression to PI3K signaling pathway
N00094  EGF-Jak-STAT signaling pathway
N00095  ERBB2-overexpression to EGF-Jak-STAT signaling pathway
N00096  EGF-EGFR-RAS-RASSF1 signaling pathway
N00103  EGF-EGFR-RAS-RalGDS signaling pathway
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00252  Amplified ERBB2 to RAS-ERK signaling pathway
N00253  Amplified ERBB2 to PI3K signaling pathway
N00276  EGF-overexpression to RAS-ERK signaling pathway
N00281  EGF-overexpression to PI3K signaling pathway
N00390  EGF-EGFR-PI3K-NFKB signaling pathway
N00542  EGF-EGFR-RAS-JNK signaling pathway
N01078  EGF-EGFR-Actin signaling pathway
N01364  E2 to nuclear-initiated estrogen signaling pathway
Disease
H00020  Colorectal cancer
H01210  Hypomagnesemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1950 (EGF)
   04012 ErbB signaling pathway
    1950 (EGF)
   04014 Ras signaling pathway
    1950 (EGF)
   04015 Rap1 signaling pathway
    1950 (EGF)
   04630 JAK-STAT signaling pathway
    1950 (EGF)
   04066 HIF-1 signaling pathway
    1950 (EGF)
   04068 FoxO signaling pathway
    1950 (EGF)
   04020 Calcium signaling pathway
    1950 (EGF)
   04072 Phospholipase D signaling pathway
    1950 (EGF)
   04151 PI3K-Akt signaling pathway
    1950 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    1950 (EGF)
   04540 Gap junction
    1950 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    1950 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1950 (EGF)
   05207 Chemical carcinogenesis - receptor activation
    1950 (EGF)
   05208 Chemical carcinogenesis - reactive oxygen species
    1950 (EGF)
   05231 Choline metabolism in cancer
    1950 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    1950 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    1950 (EGF)
   05212 Pancreatic cancer
    1950 (EGF)
   05226 Gastric cancer
    1950 (EGF)
   05214 Glioma
    1950 (EGF)
   05218 Melanoma
    1950 (EGF)
   05219 Bladder cancer
    1950 (EGF)
   05215 Prostate cancer
    1950 (EGF)
   05213 Endometrial cancer
    1950 (EGF)
   05224 Breast cancer
    1950 (EGF)
   05223 Non-small cell lung cancer
    1950 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    1950 (EGF)
   05165 Human papillomavirus infection
    1950 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    1950 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1950 (EGF)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1950 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition EGF EGF_CA cEGF EGF_3 DUF5050
Other DBs
NCBI-GeneID: 1950
NCBI-ProteinID: NP_001954
OMIM: 131530
HGNC: 3229
Ensembl: ENSG00000138798
Pharos: P01133(Tbio)
UniProt: P01133
Structure
LinkDB
Position
4:109912883..110013766
AA seq 1207 aa
MLLTLIILLPVVSKFSFVSLSAPQHWSCPEGTLAGNGNSTCVGPAPFLIFSHGNSIFRID
TEGTNYEQLVVDAGVSVIMDFHYNEKRIYWVDLERQLLQRVFLNGSRQERVCNIEKNVSG
MAINWINEEVIWSNQQEGIITVTDMKGNNSHILLSALKYPANVAVDPVERFIFWSSEVAG
SLYRADLDGVGVKALLETSEKITAVSLDVLDKRLFWIQYNREGSNSLICSCDYDGGSVHI
SKHPTQHNLFAMSLFGDRIFYSTWKMKTIWIANKHTGKDMVRINLHSSFVPLGELKVVHP
LAQPKAEDDTWEPEQKLCKLRKGNCSSTVCGQDLQSHLCMCAEGYALSRDRKYCEDVNEC
AFWNHGCTLGCKNTPGSYYCTCPVGFVLLPDGKRCHQLVSCPRNVSECSHDCVLTSEGPL
CFCPEGSVLERDGKTCSGCSSPDNGGCSQLCVPLSPVSWECDCFPGYDLQLDEKSCAASG
PQPFLLFANSQDIRHMHFDGTDYGTLLSQQMGMVYALDHDPVENKIYFAHTALKWIERAN
MDGSQRERLIEEGVDVPEGLAVDWIGRRFYWTDRGKSLIGRSDLNGKRSKIITKENISQP
RGIAVHPMAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCD
AKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVR
LQGSMLKPSSLVVVHPLAKPGADPCLYQNGGCEHICKKRLGTAWCSCREGFMKASDGKTC
LALDGHQLLAGGEVDLKNQVTPLDILSKTRVSEDNITESQHMLVAEIMVSDQDDCAPVGC
SMYARCISEGEDATCQCLKGFAGDGKLCSDIDECEMGVPVCPPASSKCINTEGGYVCRCS
EGYQGDGIHCLDIDECQLGEHSCGENASCTNTEGGYTCMCAGRLSEPGLICPDSTPPPHL
REDDHHYSVRNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWW
ELRHAGHGQQQKVIVVAVCVVVLVMLLLLSLWGAHYYRTQKLLSKNPKNPYEESSRDVRS
RRPADTEDGMSSCPQPWFVVIKEHQDLKNGGQPVAGEDGQAADGSMQPTSWRQEPQLCGM
GTEQGCWIPVSSDKGSCPQVMERSFHMPSYGTQTLEGGVEKPHSLLSANPLWQQRALDPP
HQMELTQ
NT seq 3624 nt   +upstreamnt  +downstreamnt
atgctgctcactcttatcattctgttgccagtagtttcaaaatttagttttgttagtctc
tcagcaccgcagcactggagctgtcctgaaggtactctcgcaggaaatgggaattctact
tgtgtgggtcctgcacccttcttaattttctcccatggaaatagtatctttaggattgac
acagaaggaaccaattatgagcaattggtggtggatgctggtgtctcagtgatcatggat
tttcattataatgagaaaagaatctattgggtggatttagaaagacaacttttgcaaaga
gtttttctgaatgggtcaaggcaagagagagtatgtaatatagagaaaaatgtttctgga
atggcaataaattggataaatgaagaagttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggaaataattcccacattcttttaagtgctttaaaatatcct
gcaaatgtagcagttgatccagtagaaaggtttatattttggtcttcagaggtggctgga
agcctttatagagcagatctcgatggtgtgggagtgaaggctctgttggagacatcagag
aaaataacagctgtgtcattggatgtgcttgataagcggctgttttggattcagtacaac
agagaaggaagcaattctcttatttgctcctgtgattatgatggaggttctgtccacatt
agtaaacatccaacacagcataatttgtttgcaatgtccctttttggtgaccgtatcttc
tattcaacatggaaaatgaagacaatttggatagccaacaaacacactggaaaggacatg
gttagaattaacctccattcatcatttgtaccacttggtgaactgaaagtagtgcatcca
cttgcacaacccaaggcagaagatgacacttgggagcctgagcagaaactttgcaaattg
aggaaaggaaactgcagcagcactgtgtgtgggcaagacctccagtcacacttgtgcatg
tgtgcagagggatacgccctaagtcgagaccggaagtactgtgaagatgttaatgaatgt
gctttttggaatcatggctgtactcttgggtgtaaaaacacccctggatcctattactgc
acgtgccctgtaggatttgttctgcttcctgatgggaaacgatgtcatcaacttgtttcc
tgtccacgcaatgtgtctgaatgcagccatgactgtgttctgacatcagaaggtccctta
tgtttctgtcctgaaggctcagtgcttgagagagatgggaaaacatgtagcggttgttcc
tcacccgataatggtggatgtagccagctctgcgttcctcttagcccagtatcctgggaa
tgtgattgctttcctgggtatgacctacaactggatgaaaaaagctgtgcagcttcagga
ccacaaccatttttgctgtttgccaattctcaagatattcgacacatgcattttgatgga
acagactatggaactctgctcagccagcagatgggaatggtttatgccctagatcatgac
cctgtggaaaataagatatactttgcccatacagccctgaagtggatagagagagctaat
atggatggttcccagcgagaaaggcttattgaggaaggagtagatgtgccagaaggtctt
gctgtggactggattggccgtagattctattggacagacagagggaaatctctgattgga
aggagtgatttaaatgggaaacgttccaaaataatcactaaggagaacatctctcaacca
cgaggaattgctgttcatccaatggccaagagattattctggactgatacagggattaat
ccacgaattgaaagttcttccctccaaggccttggccgtctggttatagccagctctgat
ctaatctggcccagtggaataacgattgacttcttaactgacaagttgtactggtgcgat
gccaagcagtctgtgattgaaatggccaatctggatggttcaaaacgccgaagacttacc
cagaatgatgtaggtcacccatttgctgtagcagtgtttgaggattatgtgtggttctca
gattgggctatgccatcagtaatgagagtaaacaagaggactggcaaagatagagtacgt
ctccaaggcagcatgctgaagccctcatcactggttgtggttcatccattggcaaaacca
ggagcagatccctgcttatatcaaaacggaggctgtgaacatatttgcaaaaagaggctt
ggaactgcttggtgttcgtgtcgtgaaggttttatgaaagcctcagatgggaaaacgtgt
ctggctctggatggtcatcagctgttggcaggtggtgaagttgatctaaagaaccaagta
acaccattggacatcttgtccaagactagagtgtcagaagataacattacagaatctcaa
cacatgctagtggctgaaatcatggtgtcagatcaagatgactgtgctcctgtgggatgc
agcatgtatgctcggtgtatttcagagggagaggatgccacatgtcagtgtttgaaagga
tttgctggggatggaaaactatgttctgatatagatgaatgtgagatgggtgtcccagtg
tgcccccctgcctcctccaagtgcatcaacaccgaaggtggttatgtctgccggtgctca
gaaggctaccaaggagatgggattcactgtcttgatattgatgagtgccaactgggggag
cacagctgtggagagaatgccagctgcacaaatacagagggaggctatacctgcatgtgt
gctggacgcctgtctgaaccaggactgatttgccctgactctactccaccccctcacctc
agggaagatgaccaccactattccgtaagaaatagtgactctgaatgtcccctgtcccac
gatgggtactgcctccatgatggtgtgtgcatgtatattgaagcattggacaagtatgca
tgcaactgtgttgttggctacatcggggagcgatgtcagtaccgagacctgaagtggtgg
gaactgcgccacgctggccacgggcagcagcagaaggtcatcgtggtggctgtctgcgtg
gtggtgcttgtcatgctgctcctcctgagcctgtggggggcccactactacaggactcag
aagctgctatcgaaaaacccaaagaatccttatgaggagtcgagcagagatgtgaggagt
cgcaggcctgctgacactgaggatgggatgtcctcttgccctcaaccttggtttgtggtt
ataaaagaacaccaagacctcaagaatgggggtcaaccagtggctggtgaggatggccag
gcagcagatgggtcaatgcaaccaacttcatggaggcaggagccccagttatgtggaatg
ggcacagagcaaggctgctggattccagtatccagtgataagggctcctgtccccaggta
atggagcgaagctttcatatgccctcctatgggacacagacccttgaagggggtgtcgag
aagccccattctctcctatcagctaacccattatggcaacaaagggccctggacccacca
caccaaatggagctgactcagtga

KEGG   Homo sapiens (human): 2246
Entry
2246              CDS       T01001                                 
Symbol
FGF1, AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-1, FGF-alpha, FGFA, GLIO703, HBGF-1, HBGF1
Name
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06261  Gastric cancer
nt06265  Bladder cancer
nt06270  Breast cancer
nt06361  Hypogonadotropic hypogonadism
  Element
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2246 (FGF1)
   04014 Ras signaling pathway
    2246 (FGF1)
   04015 Rap1 signaling pathway
    2246 (FGF1)
   04390 Hippo signaling pathway
    2246 (FGF1)
   04020 Calcium signaling pathway
    2246 (FGF1)
   04151 PI3K-Akt signaling pathway
    2246 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2246 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2246 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    2246 (FGF1)
   05218 Melanoma
    2246 (FGF1)
   05224 Breast cancer
    2246 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2246 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2246 (FGF1)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2246 (FGF1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   2246 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 2246
NCBI-ProteinID: NP_000791
OMIM: 131220
HGNC: 3665
Ensembl: ENSG00000113578
Pharos: P05230(Tchem)
UniProt: P05230 A0A7U3JVZ2
Structure
LinkDB
Position
5:complement(142592178..142698070)
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggggaaatcaccaccttcacagccctgaccgagaagtttaatctgcctcca
gggaattacaagaagcccaaactcctctactgtagcaacgggggccacttcctgaggatc
cttccggatggcacagtggatgggacaagggacaggagcgaccagcacattcagctgcag
ctcagtgcggaaagcgtgggggaggtgtatataaagagtaccgagactggccagtacttg
gccatggacaccgacgggcttttatacggctcacagacaccaaatgaggaatgtttgttc
ctggaaaggctggaggagaaccattacaacacctatatatccaagaagcatgcagagaag
aattggtttgttggcctcaagaagaatgggagctgcaaacgcggtcctcggactcactat
ggccagaaagcaatcttgtttctccccctgccagtctcttctgattaa

KEGG   Homo sapiens (human): 2247
Entry
2247              CDS       T01001                                 
Symbol
FGF2, BFGF, FGF-2, FGFB, HBGF-2
Name
(RefSeq) fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04810  Regulation of actin cytoskeleton
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06261  Gastric cancer
nt06265  Bladder cancer
nt06270  Breast cancer
nt06361  Hypogonadotropic hypogonadism
  Element
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2247 (FGF2)
   04014 Ras signaling pathway
    2247 (FGF2)
   04015 Rap1 signaling pathway
    2247 (FGF2)
   04020 Calcium signaling pathway
    2247 (FGF2)
   04151 PI3K-Akt signaling pathway
    2247 (FGF2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    2247 (FGF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2247 (FGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2247 (FGF2)
   05205 Proteoglycans in cancer
    2247 (FGF2)
   05207 Chemical carcinogenesis - receptor activation
    2247 (FGF2)
  09162 Cancer: specific types
   05226 Gastric cancer
    2247 (FGF2)
   05218 Melanoma
    2247 (FGF2)
   05224 Breast cancer
    2247 (FGF2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    2247 (FGF2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    2247 (FGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2247 (FGF2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2247 (FGF2)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2247 (FGF2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   2247 (FGF2)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 2247
NCBI-ProteinID: NP_001997
OMIM: 134920
HGNC: 3676
Ensembl: ENSG00000138685
Pharos: P09038(Tchem)
UniProt: P09038
Structure
LinkDB
Position
4:122826682..122898236
AA seq 288 aa
MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NT seq 867 nt   +upstreamnt  +downstreamnt
ctggtgggtgtggggggtggagatgtagaagatgtgacgccgcggcccggcgggtgccag
attagcggacgcggtgcccgcggttgcaacgggatcccgggcgctgcagcttgggaggcg
gctctccccaggcggcgtccgcggagacacccatccgtgaaccccaggtcccgggccgcc
ggctcgccgcgcaccaggggccggcggacagaagagcggccgagcggctcgaggctgggg
gaccgcgggcgcggccgcgcgctgccgggcgggaggctggggggccggggccggggccgt
gccccggagcgggtcggaggccggggccggggccgggggacggcggctccccgcgcggct
ccagcggctcggggatcccggccgggccccgcagggaccatggcagccgggagcatcacc
acgctgcccgccttgcccgaggatggcggcagcggcgccttcccgcccggccacttcaag
gaccccaagcggctgtactgcaaaaacgggggcttcttcctgcgcatccaccccgacggc
cgagttgacggggtccgggagaagagcgaccctcacatcaagctacaacttcaagcagaa
gagagaggagttgtgtctatcaaaggagtgtgtgctaaccgttacctggctatgaaggaa
gatggaagattactggcttctaaatgtgttacggatgagtgtttcttttttgaacgattg
gaatctaataactacaatacttaccggtcaaggaaatacaccagttggtatgtggcactg
aaacgaactgggcagtataaacttggatccaaaacaggacctgggcagaaagctatactt
tttcttccaatgtctgctaagagctga

KEGG   Homo sapiens (human): 2248
Entry
2248              CDS       T01001                                 
Symbol
FGF3, HBGF-3, INT2
Name
(RefSeq) fibroblast growth factor 3
  KO
K04358  fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06261  Gastric cancer
nt06265  Bladder cancer
nt06270  Breast cancer
nt06361  Hypogonadotropic hypogonadism
  Element
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Disease
H00041  Kaposi sarcoma
H02286  Congenital deafness with inner ear agenesis, microtia, and microdontia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2248 (FGF3)
   04014 Ras signaling pathway
    2248 (FGF3)
   04015 Rap1 signaling pathway
    2248 (FGF3)
   04020 Calcium signaling pathway
    2248 (FGF3)
   04151 PI3K-Akt signaling pathway
    2248 (FGF3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2248 (FGF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2248 (FGF3)
   05207 Chemical carcinogenesis - receptor activation
    2248 (FGF3)
  09162 Cancer: specific types
   05226 Gastric cancer
    2248 (FGF3)
   05218 Melanoma
    2248 (FGF3)
   05224 Breast cancer
    2248 (FGF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2248 (FGF3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2248 (FGF3)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2248 (FGF3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   2248 (FGF3)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 2248
NCBI-ProteinID: NP_005238
OMIM: 164950
HGNC: 3681
Ensembl: ENSG00000186895
Pharos: P11487(Tbio)
UniProt: P11487 A0A7U3JVY0
LinkDB
Position
11:complement(69809968..69819416)
AA seq 239 aa
MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHP
SGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMNKRGRLYASEHYSAECEFVER
IHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLP
RVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPSHVQASRLGSQLEASAH
NT seq 720 nt   +upstreamnt  +downstreamnt
atgggcctaatctggctgctactgctcagcctgctggagcccggctggcccgcagcgggc
cctggggcgcggttgcggcgcgatgcgggcggccgtggcggcgtctacgagcaccttggc
ggggcgccccggcgccgcaagctctactgcgccacgaagtaccacctccagctgcacccg
agcggccgcgtcaacggcagcctggagaacagcgcctacagtattttggagataacggca
gtggaggtgggcattgtggccatcaggggtctcttctccgggcggtacctggccatgaac
aagaggggacgactctatgcttcggagcactacagcgccgagtgcgagtttgtggagcgg
atccacgagctgggctataatacgtatgcctcccggctgtaccggacggtgtctagtacg
cctggggcccgccggcagcccagcgccgagagactgtggtacgtgtctgtgaacggcaag
ggccggccccgcaggggcttcaagacccgccgcacacagaagtcctccctgttcctgccc
cgcgtgctggaccacagggaccacgagatggtgcggcagctacagagtgggctgcccaga
ccccctggtaagggggtccagccccgacggcggcggcagaagcagagcccggataacctg
gagccctctcacgttcaggcttcgagactgggctcccagctggaggccagtgcgcactag

KEGG   Homo sapiens (human): 2249
Entry
2249              CDS       T01001                                 
Symbol
FGF4, FGF-4, HBGF-4, HST, HST-1, HSTF-1, HSTF1, K-FGF, KFGF
Name
(RefSeq) fibroblast growth factor 4
  KO
K04358  fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06261  Gastric cancer
nt06265  Bladder cancer
nt06270  Breast cancer
nt06361  Hypogonadotropic hypogonadism
  Element
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2249 (FGF4)
   04014 Ras signaling pathway
    2249 (FGF4)
   04015 Rap1 signaling pathway
    2249 (FGF4)
   04020 Calcium signaling pathway
    2249 (FGF4)
   04151 PI3K-Akt signaling pathway
    2249 (FGF4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2249 (FGF4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2249 (FGF4)
   05207 Chemical carcinogenesis - receptor activation
    2249 (FGF4)
  09162 Cancer: specific types
   05226 Gastric cancer
    2249 (FGF4)
   05218 Melanoma
    2249 (FGF4)
   05224 Breast cancer
    2249 (FGF4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2249 (FGF4)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2249 (FGF4)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2249 (FGF4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   2249 (FGF4)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 2249
NCBI-ProteinID: NP_001998
OMIM: 164980
HGNC: 3682
Ensembl: ENSG00000075388
Pharos: P08620(Tbio)
UniProt: P08620 A0A7U3JW12
Structure
LinkDB
Position
11:complement(69771022..69775341)
AA seq 206 aa
MSGPGTAAVALLPAVLLALLAPWAGRGGAAAPTAPNGTLEAELERRWESLVALSLARLPV
AAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSP
VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIA
LSKNGKTKKGNRVSPTMKVTHFLPRL
NT seq 621 nt   +upstreamnt  +downstreamnt
atgtcggggcccgggacggccgcggtagcgctgctcccggcggtcctgctggccttgctg
gcgccctgggcgggccgagggggcgccgccgcacccactgcacccaacggcacgctggag
gccgagctggagcgccgctgggagagcctggtggcgctctcgttggcgcgcctgccggtg
gcagcgcagcccaaggaggcggccgtccagagcggcgccggcgactacctgctgggcatc
aagcggctgcggcggctctactgcaacgtgggcatcggcttccacctccaggcgctcccc
gacggccgcatcggcggcgcgcacgcggacacccgcgacagcctgctggagctctcgccc
gtggagcggggcgtggtgagcatcttcggcgtggccagccggttcttcgtggccatgagc
agcaagggcaagctctatggctcgcccttcttcaccgatgagtgcacgttcaaggagatt
ctccttcccaacaactacaacgcctacgagtcctacaagtaccccggcatgttcatcgcc
ctgagcaagaatgggaagaccaagaaggggaaccgagtgtcgcccaccatgaaggtcacc
cacttcctccccaggctgtga

KEGG   Homo sapiens (human): 2250
Entry
2250              CDS       T01001                                 
Symbol
FGF5, HBGF-5, Smag-82, TCMGLY
Name
(RefSeq) fibroblast growth factor 5
  KO
K04358  fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06261  Gastric cancer
nt06265  Bladder cancer
nt06270  Breast cancer
nt06361  Hypogonadotropic hypogonadism
  Element
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Disease
H01905  Trichomegaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2250 (FGF5)
   04014 Ras signaling pathway
    2250 (FGF5)
   04015 Rap1 signaling pathway
    2250 (FGF5)
   04020 Calcium signaling pathway
    2250 (FGF5)
   04151 PI3K-Akt signaling pathway
    2250 (FGF5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2250 (FGF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2250 (FGF5)
   05207 Chemical carcinogenesis - receptor activation
    2250 (FGF5)
  09162 Cancer: specific types
   05226 Gastric cancer
    2250 (FGF5)
   05218 Melanoma
    2250 (FGF5)
   05224 Breast cancer
    2250 (FGF5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2250 (FGF5)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2250 (FGF5)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2250 (FGF5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   2250 (FGF5)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 2250
NCBI-ProteinID: NP_004455
OMIM: 165190
HGNC: 3683
Ensembl: ENSG00000138675
Pharos: P12034(Tbio)
UniProt: P12034 Q8NBG6 A0A7U3L5M4
LinkDB
Position
4:80266588..80291017
AA seq 268 aa
MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSAS
SSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSV
LEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHR
TEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPP
SPIKPKIPLSAPRKNTNSVKYRLKFRFG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgagcttgtccttcctcctcctcctcttcttcagccacctgatcctcagcgcctgggct
cacggggagaagcgtctcgcccccaaagggcaacccggacccgctgccactgataggaac
cctagaggctccagcagcagacagagcagcagtagcgctatgtcttcctcttctgcctcc
tcctcccccgcagcttctctgggcagccaaggaagtggcttggagcagagcagtttccag
tggagcccctcggggcgccggaccggcagcctctactgcagagtgggcatcggtttccat
ctgcagatctacccggatggcaaagtcaatggatcccacgaagccaatatgttaagtgtt
ttggaaatatttgctgtgtctcaggggattgtaggaatacgaggagttttcagcaacaaa
tttttagcgatgtcaaaaaaaggaaaactccatgcaagtgccaagttcacagatgactgc
aagttcagggagcgttttcaagaaaatagctataatacctatgcctcagcaatacataga
actgaaaaaacagggcgggagtggtatgtggccctgaataaaagaggaaaagccaaacga
gggtgcagcccccgggttaaaccccagcatatctctacccattttctgccaagattcaag
cagtcggagcagccagaactttctttcacggttactgttcctgaaaagaaaaagccacct
agccctatcaagccaaagattcccctttctgcacctcggaaaaataccaactcagtgaaa
tacagactcaagtttcgctttggataa

KEGG   Homo sapiens (human): 2251
Entry
2251              CDS       T01001                                 
Symbol
FGF6, HBGF-6, HST2
Name
(RefSeq) fibroblast growth factor 6
  KO
K04358  fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06261  Gastric cancer
nt06265  Bladder cancer
nt06270  Breast cancer
nt06361  Hypogonadotropic hypogonadism
  Element
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2251 (FGF6)
   04014 Ras signaling pathway
    2251 (FGF6)
   04015 Rap1 signaling pathway
    2251 (FGF6)
   04020 Calcium signaling pathway
    2251 (FGF6)
   04151 PI3K-Akt signaling pathway
    2251 (FGF6)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2251 (FGF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2251 (FGF6)
   05207 Chemical carcinogenesis - receptor activation
    2251 (FGF6)
  09162 Cancer: specific types
   05226 Gastric cancer
    2251 (FGF6)
   05218 Melanoma
    2251 (FGF6)
   05224 Breast cancer
    2251 (FGF6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2251 (FGF6)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2251 (FGF6)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2251 (FGF6)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   2251 (FGF6)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 2251
NCBI-ProteinID: NP_066276
OMIM: 134921
HGNC: 3684
Ensembl: ENSG00000111241
Pharos: P10767(Tbio)
UniProt: P10767 A0A7U3JW05
LinkDB
Position
12:complement(4434142..4445815)
AA seq 208 aa
MALGQKLFITMSRGAGRLQGTLWALVFLGILVGMVVPSPAGTRANNTLLDSRGWGTLLSR
SRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVLPDGRISGTHEENPYSLLEI
STVERGVVSLFGVRSALFVAMNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYQGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI
NT seq 627 nt   +upstreamnt  +downstreamnt
atggccctgggacagaaactgttcatcactatgtcccggggagcaggacgtctgcagggc
acgctgtgggctctcgtcttcctaggcatcctagtgggcatggtggtgccctcgcctgca
ggcacccgtgccaacaacacgctgctggactcgaggggctggggcaccctgctgtccagg
tctcgcgccgggctagctggagagattgccggggtgaactgggaaagtggctatttggtg
gggatcaagcggcagcggaggctctactgcaacgtgggcatcggctttcacctccaggtg
ctccccgacggccggatcagcgggacccacgaggagaacccctacagcctgctggaaatt
tccactgtggagcgaggcgtggtgagtctctttggagtgagaagtgccctcttcgttgcc
atgaacagtaaaggaagattgtacgcaacgcccagcttccaagaagaatgcaagttcaga
gaaaccctcctgcccaacaattacaatgcctacgagtcagacttgtaccaagggacctac
attgccctgagcaaatacggacgggtaaagcggggcagcaaggtgtccccgatcatgact
gtcactcatttccttcccaggatctaa

KEGG   Homo sapiens (human): 2252
Entry
2252              CDS       T01001                                 
Symbol
FGF7, HBGF-7, KGF
Name
(RefSeq) fibroblast growth factor 7
  KO
K04358  fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06261  Gastric cancer
nt06265  Bladder cancer
nt06270  Breast cancer
nt06361  Hypogonadotropic hypogonadism
  Element
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2252 (FGF7)
   04014 Ras signaling pathway
    2252 (FGF7)
   04015 Rap1 signaling pathway
    2252 (FGF7)
   04020 Calcium signaling pathway
    2252 (FGF7)
   04151 PI3K-Akt signaling pathway
    2252 (FGF7)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2252 (FGF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2252 (FGF7)
   05207 Chemical carcinogenesis - receptor activation
    2252 (FGF7)
  09162 Cancer: specific types
   05226 Gastric cancer
    2252 (FGF7)
   05218 Melanoma
    2252 (FGF7)
   05224 Breast cancer
    2252 (FGF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2252 (FGF7)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2252 (FGF7)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2252 (FGF7)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   2252 (FGF7)
SSDB
Motif
Pfam: FGF Fascin Gb3_synth
Other DBs
NCBI-GeneID: 2252
NCBI-ProteinID: NP_002000
OMIM: 148180
HGNC: 3685
Ensembl: ENSG00000140285
Pharos: P21781(Tbio)
UniProt: P21781 A0A7U3JVY2
LinkDB
Position
15:49423242..49488775
AA seq 194 aa
MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTK
KEQKTAHFLPMAIT
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcacaaatggatactgacatggatcctgccaactttgctctacagatcatgctttcac
attatctgtctagtgggtactatatctttagcttgcaatgacatgactccagagcaaatg
gctacaaatgtgaactgttccagccctgagcgacacacaagaagttatgattacatggaa
ggaggggatataagagtgagaagactcttctgtcgaacacagtggtacctgaggatcgat
aaaagaggcaaagtaaaagggacccaagagatgaagaataattacaatatcatggaaatc
aggacagtggcagttggaattgtggcaatcaaaggggtggaaagtgaattctatcttgca
atgaacaaggaaggaaaactctatgcaaagaaagaatgcaatgaagattgtaacttcaaa
gaactaattctggaaaaccattacaacacatatgcatcagctaaatggacacacaacgga
ggggaaatgtttgttgccttaaatcaaaaggggattcctgtaagaggaaaaaaaacgaag
aaagaacaaaaaacagcccactttcttcctatggcaataacttaa

KEGG   Homo sapiens (human): 2253
Entry
2253              CDS       T01001                                 
Symbol
FGF8, AIGF, FGF-8, HBGF-8, HH6, KAL6
Name
(RefSeq) fibroblast growth factor 8
  KO
K04358  fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06261  Gastric cancer
nt06265  Bladder cancer
nt06270  Breast cancer
nt06361  Hypogonadotropic hypogonadism
  Element
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
N00876  Mutation-inactivated FGF8 to RAS-ERK signaling pathway
N00878  Mutation-inactivated FGFR1 to RAS-ERK signaling pathway
Disease
H00255  Hypogonadotropic hypogonadism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2253 (FGF8)
   04014 Ras signaling pathway
    2253 (FGF8)
   04015 Rap1 signaling pathway
    2253 (FGF8)
   04020 Calcium signaling pathway
    2253 (FGF8)
   04151 PI3K-Akt signaling pathway
    2253 (FGF8)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2253 (FGF8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2253 (FGF8)
   05207 Chemical carcinogenesis - receptor activation
    2253 (FGF8)
  09162 Cancer: specific types
   05226 Gastric cancer
    2253 (FGF8)
   05218 Melanoma
    2253 (FGF8)
   05224 Breast cancer
    2253 (FGF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2253 (FGF8)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2253 (FGF8)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2253 (FGF8)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   2253 (FGF8)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 2253
NCBI-ProteinID: NP_149354
OMIM: 600483
HGNC: 3686
Ensembl: ENSG00000107831
Pharos: P55075(Tbio)
UniProt: P55075 A1A515
Structure
LinkDB
Position
10:complement(101770109..101780369)
AA seq 233 aa
MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLV
TDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGA
ETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKG
SKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
NT seq 702 nt   +upstreamnt  +downstreamnt
atgggcagcccccgctccgcgctgagctgcctgctgttgcacttgctggtcctctgcctc
caagcccaggaaggcccgggcaggggccctgcgctgggcagggagctcgcttccctgttc
cgggctggccgggagccccagggtgtctcccaacagcatgtgagggagcagagcctggtg
acggatcagctcagccgccgcctcatccggacctaccaactctacagccgcaccagcggg
aagcacgtgcaggtcctggccaacaagcgcatcaacgccatggcagaggacggcgacccc
ttcgcaaagctcatcgtggagacggacacctttggaagcagagttcgagtccgaggagcc
gagacgggcctctacatctgcatgaacaagaaggggaagctgatcgccaagagcaacggc
aaaggcaaggactgcgtcttcacggagattgtgctggagaacaactacacagcgctgcag
aatgccaagtacgagggctggtacatggccttcacccgcaagggccggccccgcaagggc
tccaagacgcggcagcaccagcgtgaggtccacttcatgaagcggctgccccggggccac
cacaccaccgagcagagcctgcgcttcgagttcctcaactacccgcccttcacgcgcagc
ctgcgcggcagccagaggacttgggcccccgagccccgatag

KEGG   Homo sapiens (human): 2254
Entry
2254              CDS       T01001                                 
Symbol
FGF9, FGF-9, GAF, HBFG-9, HBGF-9, SYNS3
Name
(RefSeq) fibroblast growth factor 9
  KO
K04358  fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06227  Nuclear receptor signaling
nt06261  Gastric cancer
nt06265  Bladder cancer
nt06270  Breast cancer
nt06361  Hypogonadotropic hypogonadism
  Element
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
N01364  E2 to nuclear-initiated estrogen signaling pathway
Disease
H00484  Multiple synostosis syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2254 (FGF9)
   04014 Ras signaling pathway
    2254 (FGF9)
   04015 Rap1 signaling pathway
    2254 (FGF9)
   04020 Calcium signaling pathway
    2254 (FGF9)
   04151 PI3K-Akt signaling pathway
    2254 (FGF9)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2254 (FGF9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2254 (FGF9)
   05207 Chemical carcinogenesis - receptor activation
    2254 (FGF9)
  09162 Cancer: specific types
   05226 Gastric cancer
    2254 (FGF9)
   05218 Melanoma
    2254 (FGF9)
   05224 Breast cancer
    2254 (FGF9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2254 (FGF9)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2254 (FGF9)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2254 (FGF9)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   2254 (FGF9)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 2254
NCBI-ProteinID: NP_002001
OMIM: 600921
HGNC: 3687
Ensembl: ENSG00000102678
Pharos: P31371(Tbio)
UniProt: P31371 A0A7U3L6D0
Structure
LinkDB
Position
13:21671073..21704498
AA seq 208 aa
MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKDILSQS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcccttaggtgaagttgggaactatttcggtgtgcaggatgcggtaccgtttggg
aatgtgcccgtgttgccggtggacagcccggttttgttaagtgaccacctgggtcagtcc
gaagcaggggggctccccaggggacccgcagtcacggacttggatcatttaaaggggatt
ctcaggcggaggcagctatactgcaggactggatttcacttagaaatcttccccaatggt
actatccagggaaccaggaaagaccacagccgatttggcattctggaatttatcagtata
gcagtgggcctggtcagcattcgaggcgtggacagtggactctacctcgggatgaatgag
aagggggagctgtatggatcagaaaaactaacccaagagtgtgtattcagagaacagttc
gaagaaaactggtataatacgtactcatcaaacctatataagcacgtggacactggaagg
cgatactatgttgcattaaataaagatgggaccccgagagaagggactaggactaaacgg
caccagaaattcacacattttttacctagaccagtggaccccgacaaagtacctgaactg
tataaggatattctaagccaaagttga

DBGET integrated database retrieval system