KEGG   Homo sapiens (human): 196
Entry
196               CDS       T01001                                 

Symbol
AHR, RP85, bHLHe76
Name
(RefSeq) aryl hydrocarbon receptor
  KO
K09093  aryl hydrocarbon receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04659  Th17 cell differentiation
hsa04934  Cushing syndrome
hsa05207  Chemical carcinogenesis - receptor activation
hsa05208  Chemical carcinogenesis - reactive oxygen species
Network
nt06227  Nuclear receptor signaling
nt06360  Cushing syndrome
  Element
N00315  Mutation-inactivated AIP to AhR-mediated transcription
N00317  AhR signaling pathway
N01365  TCDD to Ahr signaling pathway
N01366  BaP to Ahr signaling pathway
N01367  PCB to Ahr signaling pathway
N01368  HCB to Ahr signaling pathway
Disease
H00527  Retinitis pigmentosa
Drug target
Tapinarof: D11365
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    196 (AHR)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    196 (AHR)
   05208 Chemical carcinogenesis - reactive oxygen species
    196 (AHR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    196 (AHR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    196 (AHR)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    196 (AHR)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_4 PAS_9
Other DBs
NCBI-GeneID: 196
NCBI-ProteinID: NP_001612
OMIM: 600253
HGNC: 348
Ensembl: ENSG00000106546
Vega: OTTHUMG00000149967
Pharos: P35869(Tchem)
UniProt: P35869 A0A024R9Z8
LinkDB
Structure
PDB: 
5NJ8

Position
7p21.1
AA seq 848 aa
MNSSSANITYASRKRRKPVQKTVKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDV
INKLDKLSVLRLSVSYLRAKSFFDVALKSSPTERNGGQDNCRAANFREGLNLQEGEFLLQ
ALNGFVLVVTTDALVFYASSTIQDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNP
SQCTESGQGIEEATGLPQTVVCYNPDQIPPENSPLMERCFICRLRCLLDNSSGFLAMNFQ
GKLKYLHGQKKKGKDGSILPPQLALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGC
DAKGRIVLGYTEAELCTRGSGYQFIHAADMLYCAESHIRMIKTGESGMIVFRLLTKNNRW
TWVQSNARLLYKNGRPDYIIVTQRPLTDEEGTEHLRKRNTKLPFMFTTGEAVLYEATNPF
PAIMDPLPLRTKNGTSGKDSATTSTLSKDSLNPSSLLAAMMQQDESIYLYPASSTSSTAP
FENNFFNESMNECRNWQDNTAPMGNDTILKHEQIDQPQDVNSFAGGHPGLFQDSKNSDLY
SIMKNLGIDFEDIRHMQNEKFFRNDFSGEVDFRDIDLTDEILTYVQDSLSKSPFIPSDYQ
QQQSLALNSSCMVQEHLHLEQQQQHHQKQVVVEPQQQLCQKMKHMQVNGMFENWNSNQFV
PFNCPQQDPQQYNVFTDLHGISQEFPYKSEMDSMPYTQNFISCNQPVLPQHSKCTELDYP
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQH
THVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSEARPFP
DLTSSGFL
NT seq 2547 nt   +upstreamnt  +downstreamnt
atgaacagcagcagcgccaacatcacctacgccagtcgcaagcggcggaagccggtgcag
aaaacagtaaagccaatcccagctgaaggaatcaagtcaaatccttccaagcggcataga
gaccgacttaatacagagttggaccgtttggctagcctgctgcctttcccacaagatgtt
attaataagttggacaaactttcagttcttaggctcagcgtcagttacctgagagccaag
agcttctttgatgttgcattaaaatcctcccctactgaaagaaacggaggccaggataac
tgtagagcagcaaatttcagagaaggcctgaacttacaagaaggagaattcttattacag
gctctgaatggctttgtattagttgtcactacagatgctttggtcttttatgcttcttct
actatacaagattatctagggtttcagcagtctgatgtcatacatcagagtgtatatgaa
cttatccataccgaagaccgagctgaatttcagcgtcagctacactgggcattaaatcct
tctcagtgtacagagtctggacaaggaattgaagaagccactggtctcccccagacagta
gtctgttataacccagaccagattcctccagaaaactctcctttaatggagaggtgcttc
atatgtcgtctaaggtgtctgctggataattcatctggttttctggcaatgaatttccaa
gggaagttaaagtatcttcatggacagaaaaagaaagggaaagatggatcaatacttcca
cctcagttggctttgtttgcgatagctactccacttcagccaccatccatacttgaaatc
cggaccaaaaattttatctttagaaccaaacacaaactagacttcacacctattggttgt
gatgccaaaggaagaattgttttaggatatactgaagcagagctgtgcacgagaggctca
ggttatcagtttattcatgcagctgatatgctttattgtgccgagtcccatatccgaatg
attaagactggagaaagtggcatgatagttttccggcttcttacaaaaaacaaccgatgg
acttgggtccagtctaatgcacgcctgctttataaaaatggaagaccagattatatcatt
gtaactcagagaccactaacagatgaggaaggaacagagcatttacgaaaacgaaatacg
aagttgccttttatgtttaccactggagaagctgtgttgtatgaggcaaccaaccctttt
cctgccataatggatcccttaccactaaggactaaaaatggcactagtggaaaagactct
gctaccacatccactctaagcaaggactctctcaatcctagttccctcctggctgccatg
atgcaacaagatgagtctatttatctctatcctgcttcaagtacttcaagtactgcacct
tttgaaaacaactttttcaacgaatctatgaatgaatgcagaaattggcaagataatact
gcaccgatgggaaatgatactatcctgaaacatgagcaaattgaccagcctcaggatgtg
aactcatttgctggaggtcacccagggctctttcaagatagtaaaaacagtgacttgtac
agcataatgaaaaacctaggcattgattttgaagacatcagacacatgcagaatgaaaaa
tttttcagaaatgatttttctggtgaggttgacttcagagacattgacttaacggatgaa
atcctgacgtatgtccaagattctttaagtaagtctcccttcataccttcagattatcaa
cagcaacagtccttggctctgaactcaagctgtatggtacaggaacacctacatctagaa
cagcaacagcaacatcaccaaaagcaagtagtagtggagccacagcaacagctgtgtcag
aagatgaagcacatgcaagttaatggcatgtttgaaaattggaactctaaccaattcgtg
cctttcaattgtccacagcaagacccacaacaatataatgtctttacagacttacatggg
atcagtcaagagttcccctacaaatctgaaatggattctatgccttatacacagaacttt
atttcctgtaatcagcctgtattaccacaacattccaaatgtacagagctggactaccct
atggggagttttgaaccatccccataccccactacttctagtttagaagattttgtcact
tgtttacaacttcctgaaaaccaaaagcatggattaaatccacagtcagccataataact
cctcagacatgttatgctggggccgtgtcgatgtatcagtgccagccagaacctcagcac
acccacgtgggtcagatgcagtacaatccagtactgccaggccaacaggcatttttaaac
aagtttcagaatggagttttaaatgaaacatatccagctgaattaaataacataaataac
actcagactaccacacatcttcagccacttcatcatccgtcagaagccagaccttttcct
gatttgacatccagtggattcctgtaa

DBGET integrated database retrieval system