KEGG   Homo sapiens (human): 201266
Entry
201266            CDS       T01001                                 
Symbol
SLC39A11, C17orf26, ZIP-11, ZIP11
Name
(RefSeq) solute carrier family 39 member 11
  KO
K14717  solute carrier family 39 (zinc transporter), member 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    201266 (SLC39A11)
   05012 Parkinson disease
    201266 (SLC39A11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    201266 (SLC39A11)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   201266 (SLC39A11)
SSDB
Motif
Pfam: Zip
Other DBs
NCBI-GeneID: 201266
NCBI-ProteinID: NP_001153242
OMIM: 616508
HGNC: 14463
Ensembl: ENSG00000133195
Pharos: Q8N1S5(Tbio)
UniProt: Q8N1S5
LinkDB
Position
17:complement(72645949..73092688)
AA seq 342 aa
MLQGHSSVFQALLGTFFTWGMTAAGAALVFVFSSGQRRILDGSLGFAAGVMLAASYWSLL
APAVEMATSSGGFGAFAFFPVAVGFTLGAAFVYLADLLMPHLGAAEDPQTTLALNFGSTL
MKKKSDPEGPALLFPESELSIRIGRAGLLSDKSENGEAYQRKKAAATGLPEGPAVPVPSR
GNLAQPGGSSWRRIALLILAITIHNVPEGLAVGVGFGAIEKTASATFESARNLAIGIGIQ
NFPEGLAVSLPLRGAGFSTWRAFWYGQLSGMVEPLAGVFGAFAVVLAEPILPYALAFAAG
AMVYVVMDDIIPEAQISGNGKLASWASILGFVVMMSLDVGLG
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgctccaaggccacagctctgtgttccaggccttgctggggaccttcttcacctggggg
atgacagcagctggggcagctctcgtgttcgtattctctagtggacagaggcggatctta
gatggaagtcttggctttgctgcaggggtcatgttggcagcttcctattggtctcttctg
gccccagcagttgagatggccacgtcctctgggggcttcggtgcctttgccttcttccct
gtggctgttggcttcacccttggagcggcttttgtctacttggctgacctcctgatgcct
cacttgggtgcagcagaagacccccagacgaccctggcactgaacttcggctctacgttg
atgaagaagaagtctgatcctgagggtcccgcgctgctcttccctgagagtgaactttcc
atccggataggtagagctgggcttctttcagacaagagtgagaatggtgaggcatatcag
agaaagaaggcggcagccactggccttccagagggtcctgctgtccctgtgccttctcga
gggaatctggcacagcccggcggcagcagctggaggaggatcgcactgctcatcttggcc
atcactatacacaacgttccagagggtctcgctgttggagttggatttggggctatagaa
aagacggcatctgctacctttgagagtgccaggaatttggccattggaatcgggatccag
aatttccccgagggcctggctgtcagccttcccttgcgaggggcaggcttctccacctgg
agagctttctggtatgggcagctgagcggcatggtggagcccctggccggggtctttggt
gcctttgccgtggtgctggctgagcccatcctgccctacgctctggcctttgctgccggt
gccatggtctacgtggtcatggacgacatcatccccgaagcccagatcagtggtaatggg
aaactggcatcctgggcctccatcctgggatttgtagtgatgatgtcactggacgttggc
ctgggctag

KEGG   Homo sapiens (human): 221074
Entry
221074            CDS       T01001                                 
Symbol
SLC39A12, LZT-Hs8, ZIP-12, ZIP12, bA570F3.1
Name
(RefSeq) solute carrier family 39 member 12
  KO
K14718  solute carrier family 39 (zinc transporter), member 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    221074 (SLC39A12)
   05012 Parkinson disease
    221074 (SLC39A12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    221074 (SLC39A12)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   221074 (SLC39A12)
SSDB
Motif
Pfam: Zip ZIP4_domain
Other DBs
NCBI-GeneID: 221074
NCBI-ProteinID: NP_001138667
OMIM: 608734
HGNC: 20860
Ensembl: ENSG00000148482
Pharos: Q504Y0(Tdark)
UniProt: Q504Y0
LinkDB
Position
10:17951918..18043285
AA seq 691 aa
MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNH
SRSLIKTLLEKTGCPRRRNGMQGDCNLCFEPDALLLIAGGNFEDQLREEVVQRVSLLLLY
YIIHQEEICSSKLNMSNKEYKFYLHSLLSLRQDEDSSFLSQNETEDILAFTRQYFDTSQS
QCMETKTLQKKSGIVSSEGANESTLPQLAAMIITLSLQGVCLGQGNLPSPDYFTEYIFSS
LNRTNTLRLSELDQLLNTLWTRSTCIKNEKIHQFQRKQNNIITHDQDYSNFSSSMEKESE
DGPVSWDQTCFSARQLVEIFLQKGLSLISKEDFKQMSPGIIQQLLSCSCHLPKDQQAKLP
PTTLEKYGYSTVAVTLLTLGSMLGTALVLFHSCEENYRLILQLFVGLAVGTLSGDALLHL
IPQVLGLHKQEAPEFGHFHESKGHIWKLMGLIGGIHGFFLIEKCFILLVSPNDKQGLSLV
NGHVGHSHHLALNSELSDQAGRGKSASTIQLKSPEDSQAAEMPIGSMTASNRKCKAISLL
AIMILVGDSLHNFADGLAIGAAFSSSSESGVTTTIAILCHEIPHEMGDFAVLLSSGLSMK
TAILMNFISSLTAFMGLYIGLSVSADPCVQDWIFTVTAGMFLYLSLVEMLPEMTHVQTQR
PWMMFLLQNFGLILGWLSLLLLAIYEQNIKI
NT seq 2076 nt   +upstreamnt  +downstreamnt
atgtgcttccggacaaagctctcagtatcctgggtgccattgtttcttctactcagccgt
gttttttctactgagacagacaaaccctcagcccaggatagcagaagccgtgggagttca
ggccaaccggcagacctgctacaggttctctctgctggtgaccacccaccccacaaccac
tcaagaagcctcatcaaaacattgttggagaaaactgggtgcccacggaggagaaacgga
atgcaaggagattgcaatctgtgctttgaaccagatgcactattactaatagctggagga
aattttgaagatcagcttagagaagaagtggtccagagagtttctcttctccttctctat
tacattattcatcaggaagagatctgttcttcaaagctcaacatgagtaataaagagtat
aaattttacctacacagcctactgagcctcaggcaggatgaagattcctctttcctttca
cagaatgagacagaagatatcttggctttcaccaggcagtactttgacacttctcaaagc
cagtgtatggaaaccaaaacgctgcagaaaaaatctggaatagtgagcagtgaaggtgct
aatgaaagtacgcttcctcagttggcagccatgatcattactttgtccctccagggtgtt
tgtctgggacaaggaaacttgccttccccagactactttacagaatatattttcagttcc
ttgaatcgtacgaataccctccgcctatcagaactagaccaactcctcaacactctctgg
accagaagtacttgtatcaaaaatgagaaaatccatcaatttcaaaggaaacaaaacaac
ataataacccatgatcaggactattctaatttctcttcatccatggaaaaagagtctgag
gatggtccagtttcctgggatcagacctgcttctctgctaggcagctggtggagatattt
ctacagaagggcctctcactcatttctaaggaggactttaagcaaatgagtccagggatc
atccagcagctcctcagctgctcctgccacttacccaaggaccaacaagcaaagctgcca
cctaccactctggagaaatacggctacagcacggtggctgtcacccttctcacactgggc
tccatgctggggacagcgctggtccttttccatagctgtgaggagaactacaggcttatc
ttacagctgtttgtgggcttggccgtcgggacactgtctggggacgctctgctccacctt
atccctcaggttcttggtttacataagcaggaagccccagaatttgggcatttccatgaa
agcaaaggtcatatttggaaactgatgggattaattggaggcatccatggatttttcttg
atagaaaaatgttttattcttcttgtatcaccaaatgacaagcagggcctgtcattggtt
aatgggcacgtgggtcattcccaccatcttgcactcaactctgaattaagtgaccaggca
ggcagaggcaaatctgcttcaactatccagttgaaaagcccagaagattcacaggcagct
gaaatgcctataggcagtatgacagcctccaacagaaaatgtaaagccattagcttgtta
gcaatcatgattctggttggggacagcctgcataattttgcagatggcctagccatagga
gcagccttctcatcatcatccgagtcaggagtgaccactacgattgctatcttgtgtcat
gaaatcccacatgaaatgggagactttgccgtgctcttaagctctggactttctatgaag
actgccatcctgatgaattttataagctccctaactgccttcatgggattatacattggc
ctttccgtgtcagctgatccatgtgttcaagactggatcttcacagtcactgctgggatg
ttcttatatttatccttggttgaaatgcttcctgaaatgactcatgttcaaacacaacga
ccctggatgatgtttctcctgcaaaactttggattgatcctaggttggctttctctcctg
ctcttggctatatatgagcaaaatattaaaatataa

KEGG   Homo sapiens (human): 23516
Entry
23516             CDS       T01001                                 
Symbol
SLC39A14, HCIN, HMNDYT2, LZT-Hs4, NET34, ZIP14, cig19
Name
(RefSeq) solute carrier family 39 member 14
  KO
K14720  solute carrier family 39 (zinc transporter), member 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04216  Ferroptosis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Disease
H01938  Hypermanganesemia with dystonia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    23516 (SLC39A14)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    23516 (SLC39A14)
   05012 Parkinson disease
    23516 (SLC39A14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    23516 (SLC39A14)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   23516 (SLC39A14)
SSDB
Motif
Pfam: Zip DUF808
Other DBs
NCBI-GeneID: 23516
NCBI-ProteinID: NP_001121903
OMIM: 608736
HGNC: 20858
Ensembl: ENSG00000104635
Pharos: Q15043(Tbio)
UniProt: Q15043
LinkDB
Position
8:22367278..22434129
AA seq 492 aa
MKLLLLHPAFQSCLLLTLLGLWRTTPEAHASSLGAPAISAASFLQDLIHRYGEGDSLTLQ
QLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPT
ILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYGLLCVTVISLCSLLGASVVPFMKK
TFYKRLLLYFIALAIGTLYSNALFQLIPEAFGFNPLEDYYVSKSAVVFGGFYLFFFTEKI
LKILLKQKNEHHHGHSHYASESLPSKKDQEEGVMEKLQNGDLDHMIPQHCSSELDGKAPM
VDEKVIVGSLSVQDLQASQSACYWLKGVRYSDIGTLAWMITLSDGLHNFIDGLAIGASFT
VSVFQGISTSVAILCEEFPHELGDFVILLNAGMSIQQALFFNFLSACCCYLGLAFGILAG
SHFSANWIFALAGGMFLYISLADMFPEMNEVCQEDERKGSILIPFIIQNLGLLTGFTIMV
VLTMYSGQIQIG
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgaagctgctgctgctgcacccggccttccagagctgcctcctgctgaccctgcttggc
ttatggagaaccacccctgaggctcacgcttcatccctgggtgcaccagctatcagcgct
gcctccttcctgcaggatctaatacatcggtatggcgagggtgacagcctcactctgcag
cagctgaaggccctactcaaccacctggatgtgggagtgggccggggtaatgtcacccag
cacgtgcaaggacacaggaacctctccacgtgctttagttctggagacctcttcactgcc
cacaatttcagcgagcagtcgcggattgggagcagcgagctccaggagttctgccccacc
atcctccagcagctggattcccgggcctgcacctcggagaaccaggaaaacgaggagaat
gagcagacggaggaggggcggccaagcgctgttgaagtgtggggatacggtctcctctgt
gtgaccgtcatctccctctgctccctcctgggggccagcgtggtgcccttcatgaagaag
accttttacaagaggctgctgctctacttcatagctctggcgattggaaccctctactcc
aacgccctcttccagctcatcccggaggcatttggtttcaaccctctggaagattattat
gtctccaagtctgcagtggtgtttgggggcttttatcttttctttttcacagagaagatc
ttgaagattcttcttaagcagaaaaatgagcatcatcatggacacagccattatgcctct
gagtcgcttccctccaagaaggaccaggaggagggggtgatggagaagctgcagaacggg
gacctggaccacatgattcctcagcactgcagcagtgagctggacggcaaggcgcccatg
gtggacgagaaggtcattgtgggctcgctctctgtgcaggacctgcaggcttcccagagt
gcttgctactggctgaaaggtgtccgctactctgatatcggcactctggcctggatgatc
actctgagcgacggcctccataatttcatcgatggcctggccatcggtgcttccttcact
gtgtcagttttccaaggcatcagcacctcggtggccatcctctgtgaggagttcccacat
gagctaggagactttgtcatcctgctcaacgctgggatgagcatccaacaagctctcttc
ttcaacttcctttctgcctgctgctgctacctgggtctggcctttggcatcctggccggc
agccacttctctgccaactggatttttgcgctagctggaggaatgttcttgtatatttct
ctggctgatatgttccctgagatgaatgaggtctgtcaagaggatgaaaggaagggcagc
atcttgattccatttatcatccagaacctgggcctcctgactggattcaccatcatggtg
gtcctcaccatgtattcaggacagatccagattgggtag

KEGG   Homo sapiens (human): 25800
Entry
25800             CDS       T01001                                 
Symbol
SLC39A6, LIV-1, LIV1, ZIP6
Name
(RefSeq) solute carrier family 39 member 6
  KO
K14712  solute carrier family 39 (zinc transporter), member 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25800 (SLC39A6)
   05012 Parkinson disease
    25800 (SLC39A6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    25800 (SLC39A6)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   25800 (SLC39A6)
SSDB
Motif
Pfam: Zip Phage_Mu_Gp48
Other DBs
NCBI-GeneID: 25800
NCBI-ProteinID: NP_036451
OMIM: 608731
HGNC: 18607
Ensembl: ENSG00000141424
Pharos: Q13433(Tbio)
UniProt: Q13433
LinkDB
Position
18:complement(36108531..36129340)
AA seq 755 aa
MARKLSVILILTFALSVTNPLHELKAAAFPQTTEKISPNWESGINVDLAISTRQYHLQQL
FYRYGENNSLSVEGFRKLLQNIGIDKIKRIHIHHDHDHHSDHEHHSDHERHSDHEHHSEH
EHHSDHDHHSHHNHAASGKNKRKALCPDHDSDSSGKDPRNSQGKGAHRPEHASGRRNVKD
SVSASEVTSTVYNTVSEGTHFLETIETPRPGKLFPKDVSSSTPPSVTSKSRVSRLAGRKT
NESVSEPRKGFMYSRNTNENPQECFNASKLLTSHGMGIQVPLNATEFNYLCPAIINQIDA
RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMNRVFFKFLLSF
LVALAVGTLSGDAFLHLLPHSHASHHHSHSHEEPAMEMKRGPLFSHLSSQNIEESAYFDS
TWKGLTALGGLYFMFLVEHVLTLIKQFKDKKKKNQKKPENDDDVEIKKQLSKYESQLSTN
EEKVDTDDRTEGYLRADSQEPSHFDSQQPAVLEEEEVMIAHAHPQEVYNEYVPRGCKNKC
HSHFHDTLGQSDDLIHHHHDYHHILHHHHHQNHHPHSHSQRYSREELKDAGVATLAWMVI
MGDGLHNFSDGLAIGAAFTEGLSSGLSTSVAVFCHELPHELGDFAVLLKAGMTVKQAVLY
NALSAMLAYLGMATGIFIGHYAENVSMWIFALTAGLFMYVALVDMVPEMLHNDASDHGCS
RWGYFFLQNAGMLLGFGIMLLISIFEHKIVFRINF
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggcgaggaagttatctgtaatcttgatcctgacctttgccctctctgtcacaaatccc
cttcatgaactaaaagcagctgctttcccccagaccactgagaaaattagtccgaattgg
gaatctggcattaatgttgacttggcaatttccacacggcaatatcatctacaacagctt
ttctaccgctatggagaaaataattctttgtcagttgaagggttcagaaaattacttcaa
aatataggcatagataagattaaaagaatccatatacaccatgaccacgaccatcactca
gaccacgagcatcactcagaccatgagcgtcactcagaccatgagcatcactcagagcac
gagcatcactctgaccatgatcatcactctcaccataatcatgctgcttctggtaaaaat
aagcgaaaagctctttgcccagaccatgactcagatagttcaggtaaagatcctagaaac
agccaggggaaaggagctcaccgaccagaacatgccagtggtagaaggaatgtcaaggac
agtgttagtgctagtgaagtgacctcaactgtgtacaacactgtctctgaaggaactcac
tttctagagacaatagagactccaagacctggaaaactcttccccaaagatgtaagcagc
tccactccacccagtgtcacatcaaagagccgggtgagccggctggctggtaggaaaaca
aatgaatctgtgagtgagccccgaaaaggctttatgtattccagaaacacaaatgaaaat
cctcaggagtgtttcaatgcatcaaagctactgacatctcatggcatgggcatccaggtt
ccgctgaatgcaacagagttcaactatctctgtccagccatcatcaaccaaattgatgct
agatcttgtctgattcatacaagtgaaaagaaggctgaaatccctccaaagacctattca
ttacaaatagcctgggttggtggttttatagccatttccatcatcagtttcctgtctctg
ctgggggttatcttagtgcctctcatgaatcgggtgtttttcaaatttctcctgagtttc
cttgtggcactggccgttgggactttgagtggtgatgcttttttacaccttcttccacat
tctcatgcaagtcaccaccatagtcatagccatgaagaaccagcaatggaaatgaaaaga
ggaccacttttcagtcatctgtcttctcaaaacatagaagaaagtgcctattttgattcc
acgtggaagggtctaacagctctaggaggcctgtatttcatgtttcttgttgaacatgtc
ctcacattgatcaaacaatttaaagataagaagaaaaagaatcagaagaaacctgaaaat
gatgatgatgtggagattaagaagcagttgtccaagtatgaatctcaactttcaacaaat
gaggagaaagtagatacagatgatcgaactgaaggctatttacgagcagactcacaagag
ccctcccactttgattctcagcagcctgcagtcttggaagaagaagaggtcatgatagct
catgctcatccacaggaagtctacaatgaatatgtacccagagggtgcaagaataaatgc
cattcacatttccacgatacactcggccagtcagacgatctcattcaccaccatcatgac
taccatcatattctccatcatcaccaccaccaaaaccaccatcctcacagtcacagccag
cgctactctcgggaggagctgaaagatgccggcgtcgccactctggcctggatggtgata
atgggtgatggcctgcacaatttcagcgatggcctagcaattggtgctgcttttactgaa
ggcttatcaagtggtttaagtacttctgttgctgtgttctgtcatgagttgcctcatgaa
ttaggtgactttgctgttctactaaaggctggcatgaccgttaagcaggctgtcctttat
aatgcattgtcagccatgctggcgtatcttggaatggcaacaggaattttcattggtcat
tatgctgaaaatgtttctatgtggatatttgcacttactgctggcttattcatgtatgtt
gctctggttgatatggtacctgaaatgctgcacaatgatgctagtgaccatggatgtagc
cgctgggggtatttctttttacagaatgctgggatgcttttgggttttggaattatgtta
cttatttccatatttgaacataaaatcgtgtttcgtataaatttctag

KEGG   Homo sapiens (human): 27173
Entry
27173             CDS       T01001                                 
Symbol
SLC39A1, ZIP1, ZIRTL
Name
(RefSeq) solute carrier family 39 member 1
  KO
K14709  solute carrier family 39 (zinc transporter), member 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    27173 (SLC39A1)
   05012 Parkinson disease
    27173 (SLC39A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    27173 (SLC39A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   27173 (SLC39A1)
SSDB
Motif
Pfam: Zip YLATT
Other DBs
NCBI-GeneID: 27173
NCBI-ProteinID: NP_001258886
OMIM: 604740
HGNC: 12876
Ensembl: ENSG00000143570
Pharos: Q9NY26(Tbio)
UniProt: Q9NY26
LinkDB
Position
1:complement(153959110..153968184)
AA seq 324 aa
MGPWGEPELLVWRPEAVASEPPVPVGLEVKLGALVLLLVLTLLCSLVPICVLRRPGANHE
GSASRQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALAALHVTLQFPLQEFILAMGF
FLVLVMEQITLAYKEQSGPSPLEETRALLGTVNGGPQHWHDGPGVPQASGAPATPSALRA
CVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLLQSHLRAQVVA
GCGILFSCMTPLGIGLGAALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELASSE
QRILKVILLLAGFALLTGLLFIQI
NT seq 975 nt   +upstreamnt  +downstreamnt
atggggccctggggagagccagagctcctggtgtggcgccccgaggcggtagcttcagag
cctccagtgcctgtggggctggaggtgaagttgggggccctggtgctgctgctggtgctc
accctcctctgcagcctggtgcccatctgtgtgctgcgccggccaggagctaaccatgaa
ggctcagcttcccgccagaaagccctgagcctagtaagctgtttcgcggggggcgtcttt
ttggccacttgtctcctggacctgctgcctgactacctggctgccatagatgaggccctg
gcagccttgcacgtgacgctccagttcccactgcaagagttcatcctggccatgggcttc
ttcctggtcctggtgatggagcagatcacactggcttacaaggagcagtcagggccgtca
cctctggaggaaacaagggctctgctgggaacagtgaatggtgggccgcagcattggcat
gatgggccaggggtcccacaggcgagtggagccccagcaaccccctcagccttgcgtgcc
tgtgtactggtgttctccctggccctccactccgtgttcgaggggctggcggtagggctg
cagcgagaccgggctcgggccatggagctgtgcctggctttgctgctccacaagggcatc
ctggctgtcagcctgtccctgcggctgttgcagagccaccttagggcacaggtggtggct
ggctgtgggatcctcttctcatgcatgacacctctaggcatcgggctgggtgcagctctg
gcagagtcggcaggacctctgcaccagctggcccagtctgtgctagagggcatggcagct
ggcacctttctctatatcacctttctggaaatcctgccccaggagctggccagttctgag
caaaggatcctcaaggtcattctgctcctagcaggctttgccctgctcactggcctgctc
ttcatccaaatctag

KEGG   Homo sapiens (human): 283375
Entry
283375            CDS       T01001                                 
Symbol
SLC39A5, LZT-Hs7, MYP24, ZIP5
Name
(RefSeq) solute carrier family 39 member 5
  KO
K14711  solute carrier family 39 (zinc transporter), member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Disease
H02041  Myopia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    283375 (SLC39A5)
   05012 Parkinson disease
    283375 (SLC39A5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    283375 (SLC39A5)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   283375 (SLC39A5)
SSDB
Motif
Pfam: Zip
Other DBs
NCBI-GeneID: 283375
NCBI-ProteinID: NP_001128667
OMIM: 608730
HGNC: 20502
Ensembl: ENSG00000139540
Pharos: Q6ZMH5(Tbio)
UniProt: Q6ZMH5 A0A024RB24
LinkDB
Position
12:56230051..56237846
AA seq 540 aa
MMGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLAR
LLHSLGLGRVQGLRLGQHGPLTGRAASPAADNSTHRPQNPELSVDVWAGMPLGPSGWGDL
EESKAPHLPRGPAPSGLDLLHRLLLLDHSLADHLNEDCLNGSQLLVNFGLSPAAPLTPRQ
FALLCPALLYQIDSRVCIGAPAPAPPGDLLSALLQSALAVLLLSLPSPLSLLLLRLLGPR
LLRPLLGFLGALAVGTLCGDALLHLLPHAQEGRHAGPGGLPEKDLGPGLSVLGGLFLLFV
LENMLGLLRHRGLRPRCCRRKRRNLETRNLDPENGSGMALQPLQAAPEPGAQGQREKNSQ
HPPALAPPGHQGHSHGHQGGTDITWMVLLGDGLHNLTDGLAIGAAFSDGFSSGLSTTLAV
FCHELPHELGDFAMLLQSGLSFRRLLLLSLVSGALGLGGAVLGVGLSLGPVPLTPWVFGV
TAGVFLYVALVDMLPALLRPPEPLPTPHVLLQGLGLLLGGGLMLAITLLEERLLPVTTEG
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgatggggtccccagtgagtcatctgctggccggcttctgtgtgtgggtcgtcttgggc
tgggtagggggctcagtccccaacctgggccctgctgagcaggagcagaaccattacctg
gcccagctgtttggcctgtacggcgagaatgggacgctgactgcagggggcttggcgcgg
cttctccacagcctggggctaggccgagttcaggggcttcgcctgggacagcatgggcct
ctgactggacgggctgcatccccagctgcagacaattccacacacaggccacagaaccct
gagctgagtgtggatgtctgggcagggatgcctctgggtccctcagggtggggtgacctg
gaagagtcaaaggcccctcacctaccccgtgggccagccccctcgggcctggacctcctt
cacaggcttctgttgctggaccactcattggctgaccacctgaatgaggattgtctgaac
ggctcccagctgctggtcaattttggcttgagccccgctgctcctctgacccctcgtcag
tttgctctgctgtgcccagccctgctttatcagatcgacagccgcgtctgcatcggcgct
ccggcccctgcacccccaggggatctactatctgccctgcttcagagtgccctggcagtc
ctgttgctcagcctcccttctcccctatccctgctgctgctgcggctcctgggacctcgt
ctactacggcccttgctgggcttcctgggggccctggcggtgggcactctttgtggggat
gcactgctacatctgctaccgcatgcacaagaagggcggcacgcaggacctggcggacta
ccagagaaggacctgggcccggggctgtcagtgctcggaggcctcttcctgctctttgtg
ctggagaacatgctggggcttttgcggcaccgagggctcaggccaagatgctgcaggcga
aaacgaaggaatctcgaaacacgcaacttggatccggagaatggcagtgggatggccctt
cagcccctacaggcagctccagagccaggggctcagggccagagggagaagaacagccag
cacccaccagctctggcccctcctgggcaccaaggccacagtcatgggcaccagggtggc
actgatatcacgtggatggtcctcctgggagatggtctacacaacctcactgatgggctg
gccataggtgctgccttctctgatggcttctccagcggcctcagtaccaccttagcggtc
ttctgccatgagctgccccacgaactgggtgactttgccatgctgctccagtcagggctg
tcctttcggcggctgctgctgctgagcctcgtgtctggagccctgggattggggggtgca
gtcctgggggtggggctcagcctgggccctgtccccctcactccctgggtgtttggggtc
actgctggggtcttcctctatgtggcccttgtggacatgctaccagccctgcttcgtcct
ccggagcccctgcctacgccccatgtgctcctgcaggggctggggctgctgctggggggc
ggcctcatgcttgccataaccctgctggaggagcggctactgcccgtgaccactgagggc
tga

KEGG   Homo sapiens (human): 29985
Entry
29985             CDS       T01001                                 
Symbol
SLC39A3, ZIP-3, ZIP3
Name
(RefSeq) solute carrier family 39 member 3
  KO
K14709  solute carrier family 39 (zinc transporter), member 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29985 (SLC39A3)
   05012 Parkinson disease
    29985 (SLC39A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    29985 (SLC39A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   29985 (SLC39A3)
SSDB
Motif
Pfam: Zip IF2_N
Other DBs
NCBI-GeneID: 29985
NCBI-ProteinID: NP_653165
OMIM: 612168
HGNC: 17128
Ensembl: ENSG00000141873
Pharos: Q9BRY0(Tbio)
UniProt: Q9BRY0
LinkDB
Position
19:complement(2732524..2740076)
AA seq 314 aa
MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCF
NALLPAVREKLQKVLSLGHISTDYPLAETILLLGFFMTVFLEQLILTFRKEKPSFIDLET
FNAGSDVGSDSEYESPFMGGARGHALYVEPHGHGPSLSVQGLSRASPVRLLSLAFALSAH
SVFEGLALGLQEEGEKVVSLFVGVAVHETLVAVALGISMARSAMPLRDAAKLAVTVSAMI
PLGIGLGLGIESAQGVPGSVASVLLQGLAGGTFLFITFLEILAKELEEKSDRLLKVLFLV
LGYTVLAGMVFLKW
NT seq 945 nt   +upstreamnt  +downstreamnt
atggtgaaattgctagtggccaaaatcctgtgcatggtgggcgtgttcttcttcatgctg
ctcggctccctgctccccgtgaagatcatcgagacagattttgagaaggcccatcgctcg
aaaaagatcctctctctctgcaacacctttggaggaggggtgtttctggccacgtgcttc
aacgctctgctgcccgctgtgagggaaaagctccagaaggtcctgagcctcggccacatc
agcaccgactacccgctggccgaaaccatcctcctgctgggcttcttcatgaccgtcttc
ctggagcagctgatcctgaccttccgcaaggagaagccgtccttcatcgacctggagacc
ttcaacgccggatcggacgtgggcagcgactcggagtatgagagccccttcatggggggc
gcgcggggccacgcgctgtacgtggagccccacggccacggccccagcctgagcgtgcag
ggcctctcgcgcgccagccccgtgcgcctgctcagcctggccttcgcgctgtcggcccac
tcggtctttgagggcctggccctgggcctgcaggaggagggggagaaagtggtgagcctg
ttcgtgggggtggccgtccacgagacactggtggccgtggccctgggcatcagcatggcc
cggagtgccatgcccctgcgggacgcggccaagctggcggtcaccgtaagcgccatgatc
cccctgggcatcggcctgggcctgggcattgagagcgcccagggcgtgccgggcagcgtg
gcgtccgtgctgctgcagggcctggcgggcggcaccttcctcttcatcaccttcctggag
atcctggccaaggagctggaggagaagagtgaccgtctgctcaaggtcctcttcctggtg
ctgggctacaccgtcctggccgggatggtcttcctcaagtggtga

KEGG   Homo sapiens (human): 29986
Entry
29986             CDS       T01001                                 
Symbol
SLC39A2, 6A1, ETI-1, ZIP-2, ZIP2
Name
(RefSeq) solute carrier family 39 member 2
  KO
K14709  solute carrier family 39 (zinc transporter), member 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29986 (SLC39A2)
   05012 Parkinson disease
    29986 (SLC39A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    29986 (SLC39A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   29986 (SLC39A2)
SSDB
Motif
Pfam: Zip
Other DBs
NCBI-GeneID: 29986
NCBI-ProteinID: NP_055394
OMIM: 612166
HGNC: 17127
Ensembl: ENSG00000165794
Pharos: Q9NP94(Tbio)
UniProt: Q9NP94
LinkDB
Position
14:20999293..21001871
AA seq 309 aa
MEQLLGIKLGCLFALLALTLGCGLTPICFKWFQIDAARGHHRLVLRLLGCISAGVFLGAG
FMHMTAEALEEIESQIQKFMVQNRSASERNSSGDADSAHMEYPYGELIISLGFFFVFFLE
SLALQCCPGAAGGSTVQDEEWGGAHIFELHSHGHLPSPSKGPLRALVLLLSLSFHSVFEG
LAVGLQPTVAATVQLCLAVLAHKGLVVFGVGMRLVHLGTSSRWAVFSILLLALMSPLGLA
VGLAVTGGDSEGGRGLAQAVLEGVAAGTFLYVTFLEILPRELASPEAPLAKWSCVAAGFA
FMAFIALWA
NT seq 930 nt   +upstreamnt  +downstreamnt
atggagcaactactaggaataaaacttggctgcctgtttgccctgttggctctcactctg
ggctgtggccttactcccatctgcttcaaatggttccagattgatgcagccagaggtcat
caccggctagtcctcagactcctgggctgtatttctgctggtgttttcctgggagcaggg
ttcatgcatatgactgctgaagccctggaggaaattgaatcacagattcagaagttcatg
gtgcagaacagatcagcaagtgagagaaattcttctggtgatgctgattcagctcatatg
gagtatccctatggagagctcatcatctccctgggcttcttttttgtcttctttttggag
tcgctggcattgcagtgctgtcctggggctgctggaggatcgacagtgcaggacgaagaa
tggggtggggctcatatcttcgaactccacagccatggacatttaccctcaccctcaaag
ggtcccctccgagcccttgtcctcttgctgtcactctcctttcactcagtgtttgaaggg
ctagctgtggggctgcagccgacagtagcagctaccgtgcagctctgccttgctgtcctg
gctcataaggggcttgtggtgtttggtgtaggaatgcggctagtgcatttaggtaccagc
tcacgatgggcagtgttctccatactattattagctctcatgtcccccctgggcctagcc
gtagggctggctgtgactggaggggactctgaaggagggcggggcttagcccaggctgtg
ttagagggtgtggcagctggtaccttcctgtatgtcaccttcctagaaattcttccacgg
gagctagctagtcctgaggcccctctagctaagtggagctgtgtagccgctggttttgcc
ttcatggcctttattgccttgtgggcctga

KEGG   Homo sapiens (human): 55334
Entry
55334             CDS       T01001                                 
Symbol
SLC39A9, ZIP-9, ZIP9
Name
(RefSeq) solute carrier family 39 member 9
  KO
K14715  solute carrier family 39 (zinc transporter), member 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    55334 (SLC39A9)
   05012 Parkinson disease
    55334 (SLC39A9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55334 (SLC39A9)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   55334 (SLC39A9)
SSDB
Motif
Pfam: Zip
Other DBs
NCBI-GeneID: 55334
NCBI-ProteinID: NP_060845
OMIM: 619116
HGNC: 20182
Ensembl: ENSG00000029364
Pharos: Q9NUM3(Tbio)
UniProt: Q9NUM3 C4N9M8
LinkDB
Position
14:69398384..69462390
AA seq 307 aa
MDDFISISLLSLAMLVGCYVAGIIPLAVNFSEERLKLVTVLGAGLLCGTALAVIVPEGVH
ALYEDILEGKHHQASETHNVIASDKAAEKSVVHEHEHSHDHTQLHAYIGVSLVLGFVFML
LVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHAAADGVALGAAASTSQTSVQLIVFV
AIMLHKAPAAFGLVSFLMHAGLERNRIRKHLLVFALAAPVMSMVTYLGLSKSSKEALSEV
NATGVAMLFSAGTFLYVATVHVLPEVGGIGHSHKPDATGGRGLSRLEVAALVLGCLIPLI
LSVGHQH
NT seq 924 nt   +upstreamnt  +downstreamnt
atggatgatttcatctccattagcctgctgtctctggctatgttggtgggatgttacgtg
gccggaatcattcccttggctgttaatttctcagaggaacgactgaagctggtgactgtt
ttgggtgctggccttctctgtggaactgctctggcagtcatcgtgcctgaaggagtacat
gccctttatgaagatattcttgagggaaaacaccaccaagcaagtgaaacacataatgtg
attgcatcagacaaagcagcagaaaaatcagttgtccatgaacatgagcacagccacgac
cacacacagctgcatgcctatattggtgtttccctcgttctgggcttcgttttcatgttg
ctggtggaccagattggtaactcccatgtgcattctactgacgatccagaagcagcaagg
tctagcaattccaaaatcaccaccacgctgggtctggttgtccatgctgcagctgatggt
gttgctttgggagcagcagcatctacttcacagaccagtgtccagttaattgtgtttgtg
gcaatcatgctacataaggcaccagctgcttttggactggtttccttcttgatgcatgct
ggcttagagcggaatcgaatcagaaagcacttgctggtctttgcattggcagcaccagtt
atgtccatggtgacatacttaggactgagtaagagcagtaaagaagccctttcagaggtg
aacgccacgggagtggccatgcttttctctgccgggacatttctttatgttgccacagta
catgtcctccctgaggtgggcggaatagggcacagccacaagcccgatgccacgggaggg
agaggcctcagccgcctggaagtggcagccctggttctgggttgcctcatccctctcatc
ctgtcagtaggacaccagcattaa

KEGG   Homo sapiens (human): 55630
Entry
55630             CDS       T01001                                 
Symbol
SLC39A4, AEZ, AWMS2, ZIP4
Name
(RefSeq) solute carrier family 39 member 4
  KO
K14710  solute carrier family 39 (zinc transporter), member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04978  Mineral absorption
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Disease
H00212  Acrodermatitis enteropathica
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    55630 (SLC39A4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    55630 (SLC39A4)
   05012 Parkinson disease
    55630 (SLC39A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    55630 (SLC39A4)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   55630 (SLC39A4)
SSDB
Motif
Pfam: Zip ZIP4_domain
Other DBs
NCBI-GeneID: 55630
NCBI-ProteinID: NP_570901
OMIM: 607059
HGNC: 17129
Ensembl: ENSG00000147804
Pharos: Q6P5W5(Tbio)
UniProt: Q6P5W5
LinkDB
Position
8:complement(144412414..144416844)
AA seq 647 aa
MASLVSLELGLLLAVLVVTATASPPAGLLSLLTSGQGALDQEALGGLLNTLADRVHCANG
PCGKCLSVEDALGLGEPEGSGLPPGPVLEARYVARLSAAAVLYLSNPEGTCEDARAGLWA
SHADHLLALLESPKALTPGLSWLLQRMQARAAGQTPKMACVDIPQLLEEAVGAGAPGSAG
GVLAALLDHVRSGSCFHALPSPQYFVDFVFQQHSSEVPMTLAELSALMQRLGVGREAHSD
HSHRHRGASSRDPVPLISSSNSSSVWDTVCLSARDVMAAYGLSEQAGVTPEAWAQLSPAL
LQQQLSGACTSQSRPPVQDQLSQSERYLYGSLATLLICLCAVFGLLLLTCTGCRGVTHYI
LQTFLSLAVGAVTGDAVLHLTPKVLGLHTHSEEGLSPQPTWRLLAMLAGLYAFFLFENLF
NLLLPRDPEDLEDGPCGHSSHSHGGHSHGVSLQLAPSELRQPKPPHEGSRADLVAEESPE
LLNPEPRRLSPELRLLPYMITLGDAVHNFADGLAVGAAFASSWKTGLATSLAVFCHELPH
ELGDFAALLHAGLSVRQALLLNLASALTAFAGLYVALAVGVSEESEAWILAVATGLFLYV
ALCDMLPAMLKVRDPRPWLLFLLHNVGLLGGWTVLLLLSLYEDDITF
NT seq 1944 nt   +upstreamnt  +downstreamnt
atggcgtccctggtctcgctggagctggggctgcttctggctgtgctggtggtgacggcg
acggcgtccccgcctgctggtctgctgagcctgctcacctctggccagggcgctctggat
caagaggctctgggcggcctgttaaatacgctggcggaccgtgtgcactgcgccaacggg
ccgtgtggaaagtgcctgtctgtggaggacgccctgggcctgggcgagcctgaggggtca
gggctgcccccgggcccggtcctggaggccaggtacgtcgcccgcctcagtgccgccgcc
gtcctgtacctcagcaaccccgagggcacctgtgaggacgctcgggctggcctctgggcc
tctcatgcagaccacctcctggccctgctcgagagccccaaggccctgaccccgggcctg
agctggctgctgcagaggatgcaggcccgggctgccggccagacccccaagatggcctgc
gtagatatccctcagctgctggaggaggcggtgggggcgggggctccgggcagtgctggc
ggcgtcctggctgccctgctggaccatgtcaggagcgggtcttgcttccacgccttgccg
agccctcagtacttcgtggactttgtgttccagcagcacagcagcgaggtccctatgacg
ctggccgagctgtcagccttgatgcagcgcctgggggtgggcagggaggcccacagtgac
cacagtcatcggcacaggggagccagcagccgggaccctgtgcccctcatcagctccagc
aacagctccagtgtgtgggacacggtatgcctgagtgccagggacgtgatggctgcatat
ggactgtcggaacaggctggggtgaccccggaggcctgggcccaactgagccctgccctg
ctccaacagcagctgagtggagcctgcacctcccagtccaggccccccgtccaggaccag
ctcagccagtcagagaggtatctgtacggctccctggccacgctgctcatctgcctctgc
gcggtctttggcctcctgctgctgacctgcactggctgcaggggggtcacccactacatc
ctgcagaccttcctgagcctggcagtgggtgcagtcactggggacgctgtcctgcatctg
acgcccaaggtgctggggctgcatacacacagcgaagagggcctcagcccacagcccacc
tggcgcctcctggctatgctggccgggctctacgccttcttcctgtttgagaacctcttc
aatctcctgctgcccagggacccggaggacctggaggacgggccctgcggccacagcagc
catagccacgggggccacagccacggtgtgtccctgcagctggcacccagcgagctccgg
cagcccaagcccccccacgagggctcccgcgcagacctggtggcggaggagagcccggag
ctgctgaaccctgagcccaggagactgagcccagagttgaggctactgccctatatgatc
actctgggcgacgccgtgcacaacttcgccgacgggctggccgtgggcgccgccttcgcg
tcctcctggaagaccgggctggccacctcgctggccgtgttctgccacgagttgccacac
gagctgggggacttcgccgccttgctgcacgcggggctgtccgtgcgccaagcactgctg
ctgaacctggcctccgcgctcacggccttcgctggtctctacgtggcactcgcggttgga
gtcagcgaggagagcgaggcctggatcctggcagtggccaccggcctgttcctctacgta
gcactctgcgacatgctcccggcgatgttgaaagtacgggacccgcggccctggctcctc
ttcctgctgcacaacgtgggcctgctgggcggctggaccgtcctgctgctgctgtccctg
tacgaggatgacatcaccttctga

KEGG   Homo sapiens (human): 57181
Entry
57181             CDS       T01001                                 
Symbol
SLC39A10, LZT-Hs2
Name
(RefSeq) solute carrier family 39 member 10
  KO
K14716  solute carrier family 39 (zinc transporter), member 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    57181 (SLC39A10)
   05012 Parkinson disease
    57181 (SLC39A10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    57181 (SLC39A10)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   57181 (SLC39A10)
SSDB
Motif
Pfam: Zip Mntp
Other DBs
NCBI-GeneID: 57181
NCBI-ProteinID: NP_001120729
OMIM: 608733
HGNC: 20861
Ensembl: ENSG00000196950
Pharos: Q9ULF5(Tbio)
UniProt: Q9ULF5 A0A024R3W5 Q05C42
LinkDB
Position
2:195613029..195737700
AA seq 831 aa
MKVHMHTKFCLICLLTFIFHHCNHCHEEHDHGPEALHRQHRGMTELEPSKFSKQAAENEK
KYYIEKLFERYGENGRLSFFGLEKLLTNLGLGERKVVEINHEDLGHDHVSHLDILAVQEG
KHFHSHNHQHSHNHLNSENQTVTSVSTKRNHKCDPEKETVEVSVKSDDKHMHDHNHRLRH
HHRLHHHLDHNNTHHFHNDSITPSERGEPSNEPSTETNKTQEQSDVKLPKGKRKKKGRKS
NENSEVITPGFPPNHDQGEQYEHNRVHKPDRVHNPGHSHVHLPERNGHDPGRGHQDLDPD
NEGELRHTRKREAPHVKNNAIISLRKDLNEDDHHHECLNVTQLLKYYGHGANSPISTDLF
TYLCPALLYQIDSRLCIEHFDKLLVEDINKDKNLVPEDEANIGASAWICGIISITVISLL
SLLGVILVPIINQGCFKFLLTFLVALAVGTMSGDALLHLLPHSQGGHDHSHQHAHGHGHS
HGHESNKFLEEYDAVLKGLVALGGIYLLFIIEHCIRMFKHYKQQRGKQKWFMKQNTEEST
IGRKLSDHKLNNTPDSDWLQLKPLAGTDDSVVSEDRLNETELTDLEGQQESPPKNYLCIE
EEKIIDHSHSDGLHTIHEHDLHAAAHNHHGENKTVLRKHNHQWHHKHSHHSHGPCHSGSD
LKETGIANIAWMVIMGDGIHNFSDGLAIGAAFSAGLTGGISTSIAVFCHELPHELGDFAV
LLKAGMTVKQAIVYNLLSAMMAYIGMLIGTAVGQYANNITLWIFAVTAGMFLYVALVDML
PEMLHGDGDNEEHGFCPVGQFILQNLGLLFGFAIMLVIALYEDKIVFDIQF
NT seq 2496 nt   +upstreamnt  +downstreamnt
atgaaggtacatatgcacacaaaattttgcctcatttgtttgctgacatttatttttcat
cattgcaaccattgccatgaagaacatgaccatggccctgaagcgcttcacagacagcat
cgtggaatgacagaattggagccaagcaaattttcaaagcaagctgctgaaaatgaaaaa
aaatactatattgaaaaactttttgagcgttatggtgaaaatggaagattatcctttttt
ggtttggagaaacttttaacaaacttgggccttggagagagaaaagtagttgagattaat
catgaggatcttggccacgatcatgtttctcatttagatattttggcagttcaagaggga
aagcattttcactcacataaccaccagcattcccataatcatttaaattcagaaaatcaa
actgtgaccagtgtatccacaaaaagaaaccataaatgtgatccagagaaagagacagtt
gaagtgtctgtaaaatctgatgataaacatatgcatgaccataatcaccgcctacgtcat
caccatcgtttgcatcatcatcttgatcataacaacactcaccattttcataatgattcc
attactcccagtgagcgtggggagcctagcaatgaaccttcaacagagaccaataaaacc
caggaacaatctgatgttaaactaccgaaaggaaagaggaagaaaaaagggaggaaaagt
aatgaaaattctgaggttattacaccaggttttccccctaaccatgatcagggtgaacag
tatgagcataatcgggtccacaaacctgatcgtgtacataacccaggtcattctcatgta
catcttccagaacgtaatggtcatgatcctggtcgtggacaccaagatcttgatcctgat
aatgaaggtgaacttcgacatactagaaagagagaagcaccacatgttaaaaataatgca
ataatttctttgagaaaagatctaaatgaagatgaccatcatcatgaatgtttgaacgtc
actcagttattaaaatactatggtcatggtgccaactctcccatctcaactgatttattt
acatacctttgccctgcattgttatatcaaatcgacagcagactttgtattgagcatttt
gacaaacttttagttgaagatataaataaggataaaaacctggttcctgaagatgaggca
aatataggggcatcagcctggatttgtggtatcatttctatcactgtcattagcctgctt
tccttgctaggcgtgatcttggttcctatcattaaccaaggatgcttcaaattccttctt
acattccttgttgcattagctgtaggaacaatgagtggagacgcccttcttcatctactg
ccccattctcagggtggacatgatcacagtcaccaacatgcacatgggcatggacattct
catggacatgaatctaacaagtttttggaagaatatgatgctgtattgaaaggacttgtt
gctctaggaggcatttacttgctatttatcattgaacactgcattagaatgtttaagcac
tacaaacaacaaagaggaaaacagaaatggtttatgaaacagaacacagaagaatcaact
attggaagaaagctttcagatcacaagttaaacaatacaccagattctgactggcttcaa
ctcaagcctcttgccggaactgatgactcggttgtttctgaagatcgacttaatgaaact
gaactgacagatttagaaggccaacaagaatcccctcctaaaaattacctttgtatagaa
gaggagaaaatcatagaccattctcacagtgatggattacataccattcatgagcatgat
ctccatgctgctgcacataaccaccacggcgagaacaaaactgtgctgaggaagcataat
caccagtggcaccacaagcattctcatcattcccatggcccctgtcattctggatccgat
ctgaaagaaacaggaatagctaatatagcctggatggtgatcatgggggatggcatccac
aacttcagtgatgggctcgcaattggtgcagctttcagtgctggattgacaggaggaatc
agtacttctatagccgtcttctgtcatgaactgccacatgaattaggagattttgcagtt
cttcttaaagcaggcatgactgtaaagcaagcaattgtatacaacctcctctctgccatg
atggcttacataggcatgctcataggcacagctgttggtcagtatgccaataacatcaca
ctttggatctttgcagtcactgcaggcatgttcctctatgtagccttggtggatatgctt
ccagaaatgttgcatggtgatggtgacaatgaagaacatggcttttgtcctgtggggcaa
ttcatccttcagaatttaggattgctctttggatttgccattatgctggtgattgccctc
tatgaagataaaattgtgtttgacatccagttttga

KEGG   Homo sapiens (human): 64116
Entry
64116             CDS       T01001                                 
Symbol
SLC39A8, BIGM103, CDG2N, LZT-Hs6, PP3105, ZIP8
Name
(RefSeq) solute carrier family 39 member 8
  KO
K14714  solute carrier family 39 (zinc transporter), member 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04216  Ferroptosis
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Disease
H00119  Congenital disorders of glycosylation type II
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    64116 (SLC39A8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    64116 (SLC39A8)
   05012 Parkinson disease
    64116 (SLC39A8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    64116 (SLC39A8)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   64116 (SLC39A8)
SSDB
Motif
Pfam: Zip DUF4271
Other DBs
NCBI-GeneID: 64116
NCBI-ProteinID: NP_001128618
OMIM: 608732
HGNC: 20862
Ensembl: ENSG00000138821
Pharos: Q9C0K1(Tbio)
UniProt: Q9C0K1 A0A024RDG0
LinkDB
Position
4:complement(102251041..102345482)
AA seq 460 aa
MAPGRAVAGLLLLAAAGLGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASR
VGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHK
TRPSHSEVWGYGFLSVTIINLASLLGLILTPLIKKSYFPKILTFFVGLAIGTLFSNAIFQ
LIPEAFGFDPKVDSYVEKAVAVFGGFYLLFFFERMLKMLLKTYGQNGHTHFGNDNFGPQE
KTHQPKALPAINGVTCYANPAVTEANGHIHFDNVSVVSLQDGKKEPSSCTCLKGPKLSEI
GTIAWMITLCDALHNFIDGLAIGASCTLSLLQGLSTSIAILCEEFPHELGDFVILLNAGM
STRQALLFNFLSACSCYVGLAFGILVGNNFAPNIIFALAGGMFLYISLADMFPEMNDMLR
EKVTGRKTDFTFFMIQNAGMLTGFTAILLITLYAGEIELE
NT seq 1383 nt   +upstreamnt  +downstreamnt
atggccccgggtcgcgcggtggccgggctcctgttgctggcggccgccggcctcggagga
gtggcggaggggccagggctagccttcagcgaggatgtgctgagcgtgttcggcgcgaat
ctgagcctgtcggcggcgcagctccagcacttgctggagcagatgggagccgcctcccgc
gtgggcgtcccggagcctggccagctgcacttcaaccagtgtttaactgctgaagagatc
ttttcccttcatggcttttcaaatgctacccaaataaccagctccaaattctctgtcatc
tgtccagcagtcttacagcaattgaactttcacccatgtgaggatcggcccaagcacaaa
acaagaccaagtcattcagaagtttggggatatggattcctgtcagtgacgattattaat
ctggcatctctcctcggattgattttgactccactgataaagaaatcttatttcccaaag
attttgaccttttttgtggggctggctattgggactcttttttcaaatgcaattttccaa
cttattccagaggcatttggatttgatcccaaagtcgacagttatgttgagaaggcagtt
gctgtgtttggtggattttacctacttttcttttttgaaagaatgctaaagatgttatta
aagacatatggtcagaatggtcatacccactttggaaatgataactttggtcctcaagaa
aaaactcatcaacctaaagcattacctgccatcaatggtgtgacatgctatgcaaatcct
gctgtcacagaagctaatggacatatccattttgataatgtcagtgtggtatctctacag
gatggaaaaaaagagccaagttcatgtacctgtttgaaggggcccaaactgtcagaaata
gggacgattgcctggatgataacgctctgcgatgccctccacaatttcatcgatggcctg
gcgattggggcttcctgcaccttgtctctccttcagggactcagtacttccatagcaatc
ctatgtgaggagtttccccacgagttaggagactttgtgatcctactcaatgcagggatg
agcactcgacaagccttgctattcaacttcctttctgcatgttcctgctatgttgggcta
gcttttggcattttggtgggcaacaatttcgctccaaatattatatttgcacttgctgga
ggcatgttcctctatatttctctggcagatatgtttccagagatgaatgatatgctgaga
gaaaaggtaactggaagaaaaaccgatttcaccttcttcatgattcagaatgctggaatg
ttaactggattcacagccattctactcattaccttgtatgcaggagaaatcgaattggag
taa

KEGG   Homo sapiens (human): 7922
Entry
7922              CDS       T01001                                 
Symbol
SLC39A7, AGM9, D6S115E, D6S2244E, H2-KE4, HKE4, KE4, RING5, ZIP7
Name
(RefSeq) solute carrier family 39 member 7
  KO
K14713  solute carrier family 39 (zinc transporter), member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Disease
H00085  Agammaglobulinemias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7922 (SLC39A7)
   05012 Parkinson disease
    7922 (SLC39A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    7922 (SLC39A7)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   7922 (SLC39A7)
SSDB
Motif
Pfam: Zip
Other DBs
NCBI-GeneID: 7922
NCBI-ProteinID: NP_001070984
OMIM: 601416
HGNC: 4927
Ensembl: ENSG00000112473
Pharos: Q92504(Tbio)
UniProt: Q92504 A0A024RCX7
LinkDB
Position
6:33200867..33204437
AA seq 469 aa
MARGLGAPHWVAVGLLTWATLGLLVAGLGGHDDLHDDLQEDFHGHSHRHSHEDFHHGHSH
AHGHGHTHESIWHGHTHDHDHGHSHEDLHHGHSHGYSHESLYHRGHGHDHEHSHGGYGES
GAPGIKQDLDAVTLWAYALGATVLISAAPFFVLFLIPVESNSPRHRSLLQILLSFASGGL
LGDAFLHLIPHALEPHSHHTLEQPGHGHSHSGQGPILSVGLWVLSGIVAFLVVEKFVRHV
KGGHGHSHGHGHAHSHTRGSHGHGRQERSTKEKQSSEEEEKETRGVQKRRGGSTVPKDGP
VRPQNAEEEKRGLDLRVSGYLNLAADLAHNFTDGLAIGASFRGGRGLGILTTMTVLLHEV
PHEVGDFAILVQSGCSKKQAMRLQLLTAVGALAGTACALLTEGGAVGSEIAGGAGPGWVL
PFTAGGFIYVATVSVLPELLREASPLQSLLEVLGLLGGVIMMVLIAHLE
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggccagaggcctgggggccccccactgggtggccgtgggactgctgacctgggcgacc
ttggggcttctggtggctggactcgggggtcatgacgacctgcacgacgatctgcaagag
gacttccatggccacagccacaggcactcacatgaagatttccaccatggccacagccat
gcccatggccatggccacactcacgagagcatctggcatggacatacccacgatcacgac
catggacattcacatgaggatttacaccatggccatagccatggctactcccatgagagc
ctctaccacagaggacatggacatgaccatgagcatagccatggaggctatggggagtct
ggggctccaggcatcaagcaggacctggatgctgtcactctctgggcttatgcactgggg
gccacagtgctgatctcagcagctccattttttgtcctcttccttatccccgtggagtcg
aactctccccggcatcgctctctacttcagatcttgctcagttttgcttccggtgggctc
ctgggagatgctttcctgcacctcattcctcatgctcttgaacctcattctcaccacact
ctggagcaacccggacatggacactcccacagtggccagggccccattctgtctgtggga
ctgtgggttctcagtggaattgttgcctttcttgtcgtggagaaatttgtgagacatgtg
aaaggaggacatggtcacagtcatggacatggacacgctcacagtcatacacgtggaagt
catggacatggaagacaagagcgttctaccaaggagaagcagagctcagaggaagaagaa
aaggaaacaagaggggttcagaagaggcgaggagggagcacagtacccaaagatgggcca
gtgagacctcagaacgctgaagaagaaaaaagaggcttagacctgcgtgtgtcggggtac
ctgaatctggctgctgacttggcacacaacttcactgatggtctggccattggggcttcc
tttcgagggggccggggactagggatcctgaccacaatgactgtcctgctacatgaagtg
ccccacgaggtcggagactttgccatcttggtccagtctggctgcagcaaaaagcaggcg
atgcgtctgcaactactgacagcagtaggggcactggcaggcacagcctgtgcccttctc
actgaaggaggagcagtgggcagtgaaattgcaggtggtgcaggtcctggctgggtcctg
ccatttactgcaggtggctttatctacgtagcaacagtgtctgtgttgcccgagctgctg
agggaggcatcaccattgcaatcacttctggaggtgctggggctgctggggggagttatc
atgatggtgctgattgcccaccttgagtga

KEGG   Homo sapiens (human): 91252
Entry
91252             CDS       T01001                                 
Symbol
SLC39A13, EDSSPD3, LZT-Hs9, SCDEDS, ZIP13
Name
(RefSeq) solute carrier family 39 member 13
  KO
K14719  solute carrier family 39 (zinc transporter), member 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Disease
H02239  Ehlers-Danlos syndrome, spondylodysplastic type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    91252 (SLC39A13)
   05012 Parkinson disease
    91252 (SLC39A13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    91252 (SLC39A13)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC39: Metal ion transporter
   91252 (SLC39A13)
SSDB
Motif
Pfam: Zip
Other DBs
NCBI-GeneID: 91252
NCBI-ProteinID: NP_001121697
OMIM: 608735
HGNC: 20859
Ensembl: ENSG00000165915
Pharos: Q96H72(Tbio)
UniProt: Q96H72
LinkDB
Position
11:47407276..47416500
AA seq 371 aa
MPGCPCPGCGMAGPRLLFLTALALELLERAGGSQPALRSRGTATACRLDNKESESWGALL
SGERLDTWICSLLGSLMVGLSGVFPLLVIPLEMGTMLRSEAGAWRLKQLLSFALGGLLGN
VFLHLLPEAWAYTCSASPGGEGQSLQQQQQLGLWVIAGILTFLALEKMFLDSKEEGTSQA
PNKDPTAAAAALNGGHCLAQPAAEPGLGAVVRSIKVSGYLNLLANTIDNFTHGLAVAASF
LVSKKIGLLTTMAILLHEIPHEVGDFAILLRAGFDRWSAAKLQLSTALGGLLGAGFAICT
QSPKGVVGCSPAAEETAAWVLPFTSGGFLYIALVNVLPDLLEEEDPWRSLQQLLLLCAGI
VVMVLFSLFVD
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgcctggatgtccctgccctggctgtggcatggcgggcccaaggctcctcttcctcact
gcccttgccctggagctcttggaaagggctgggggttcccagccggccctccggagccgg
gggactgcgacggcctgtcgcctggacaacaaggaaagcgagtcctggggggctctgctg
agcggagagcggctggacacctggatctgctccctcctgggttccctcatggtggggctc
agtggggtcttcccgttgcttgtcattcccctagagatggggaccatgctgcgctcagaa
gctggggcctggcgcctgaagcagctgctcagcttcgccctggggggactcttgggcaat
gtgtttctgcatctgctgcccgaagcctgggcctacacgtgcagcgccagccctggtggt
gaggggcagagcctgcagcagcagcaacagctggggctgtgggtcattgctggcatcctg
accttcctggcgttggagaagatgttcctggacagcaaggaggaggggaccagccaggcc
cccaacaaagaccccactgctgctgccgccgcgctcaatggaggccactgtctggcccag
ccggctgcagagcccggcctcggtgccgtggtccggagcatcaaagtcagcggctacctc
aacctgctggccaacaccatcgataacttcacccacgggctggctgtggctgccagcttc
cttgtgagcaagaagatcgggctcctgacaaccatggccatcctcctgcatgagatcccc
catgaggtgggcgactttgccatcctgctccgggccggctttgaccgatggagcgcagcc
aagctgcaactctcaacagcgctggggggcctactgggcgctggcttcgccatctgtacc
cagtcccccaagggagtagttgggtgttctcccgctgcagaggagacggcagcctgggtc
ctgcccttcacctctggcggctttctctacatcgccttggtgaacgtgctccctgacctc
ttggaagaagaggacccgtggcgctccctgcagcagctgcttctgctctgtgcgggcatc
gtggtaatggtgctgttctcgctcttcgtggattaa

DBGET integrated database retrieval system