KEGG   Homo sapiens (human): 2060
Entry
2060              CDS       T01001                                 
Symbol
EPS15, AF-1P, AF1P, MLLT5
Name
(RefSeq) epidermal growth factor receptor pathway substrate 15
  KO
K12472  epidermal growth factor receptor substrate 15
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    2060 (EPS15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2060 (EPS15)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    2060 (EPS15)
SSDB
Motif
Pfam: EF-hand_4 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 ATG16 Crescentin HrpB7 TMF_DNA_bd AAA_13 UPF0242 DUF6212 EzrA Fib_alpha DUF3584 DUF948 HAP1_N RasGAP_C
Other DBs
NCBI-GeneID: 2060
NCBI-ProteinID: NP_001972
OMIM: 600051
HGNC: 3419
Ensembl: ENSG00000085832
Pharos: P42566(Tbio)
UniProt: P42566
Structure
LinkDB
Position
1:complement(51354263..51519266)
AA seq 896 aa
MAAAAQLSLTQLSSGNPVYEKYYRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLA
DTDGKGILNKQEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAEL
PWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGML
DRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWVVSPAEKAKYDEIFLKTDKDMD
GFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKDQFALAFHLISQKLIKGIDPP
HVLTPEMIPPSDRASLQKNIIGSSPVADFSAIKELDTLNNEIVDLQREKNNVEQDLKEKE
DTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCA
EEAQLISSLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQ
HLQDSQQEISSMQMKLMEMKDLENHNSQLNWCSSPHSILVNGATDYCSLSTSSSETANLN
EHVEGQSNLESEPIHQESPARSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDP
FNVDSSSLTGPVADTNLDFFQSDPFVGSDPFKDDPFGKIDPFGGDPFKGSDPFASDCFFR
QSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTVVAASDSATDPFASVFGNESF
GGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPALPPKIGTPTR
PCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADP
SNFANFSAYPSEEDMIEWAKRESEREEEQRLARLNQQEQEDLELAIALSKSEISEA
NT seq 2691 nt   +upstreamnt  +downstreamnt
atggctgcggcggcccagctctctctgacacagttatcaagtgggaatcctgtatatgaa
aaatactatagacaggttgatacaggcaatactggaagggtgttggcttctgatgctgct
gctttcctgaaaaaatcagggcttccagacttgatacttggaaagatttgggatttagcc
gacacagatggcaaaggtatcctgaacaaacaagaattctttgttgctttgcgtcttgtg
gcatgtgcccagaatggattggaagtttcactaagtagtttgaacctggctgttcctcca
ccaagatttcatgataccagtagtcctttgctaatcagtggaacctctgcagctgagctc
ccatgggctgtaaaacctgaagataaggccaaatatgatgcaatatttgatagtttaagc
ccagtgaatggatttctgtctggtgataaagtgaaaccagtgttgctcaactctaagtta
cctgtggatatccttggaagagtttgggagttgagtgatattgaccatgatggaatgctt
gacagagatgagtttgcagttgccatgtttttggtatactgtgcactggagaaagaacct
gtgccaatgtccttgcctccagccttggtgccaccatctaagagaaaaacgtgggttgta
tcccctgcagaaaaagctaaatatgatgaaatcttcctgaaaactgataaagatatggac
ggatttgtgtctggattggaggtccgtgaaatattcttgaaaacaggtttaccttctacc
ttactagcccatatatggtcattatgcgacacaaaggactgtgggaagctttcaaaggat
cagtttgccttggcttttcacttaatcagtcagaagttaatcaagggcattgatcctcct
cacgttcttactcctgaaatgattccaccatcagacagggccagtttacaaaagaacatc
ataggatcaagtcctgttgcagatttctctgctattaaggaactagatactcttaacaat
gaaatagttgacctacagagggaaaagaataatgtggaacaggaccttaaggagaaggaa
gatactattaaacagaggacaagtgaggttcaggatcttcaagatgaagttcaaagggag
aatactaatctgcaaaaactacaggcccagaaacagcaggtacaggaactccttgatgaa
ctggatgagcagaaagcccagctggaggagcaactcaaggaagtcagaaagaaatgtgct
gaggaggcccaactgatctcttctctgaaagctgaattaactagtcaggaatcgcagatc
tccacttacgaagaagaattggcaaaagctagagaagagctgagccgtctacagcaagaa
acagcagaattggaggagagtgtagagtcagggaaggctcagttggaacctcttcagcag
cacctacaagattcacaacaggaaattagttcaatgcaaatgaaactgatggaaatgaaa
gatttggaaaatcataatagtcagttaaattggtgcagtagcccacacagcattcttgta
aacggagctacagattattgcagcctcagcaccagcagcagtgaaacagccaaccttaat
gaacatgttgaaggccagagcaacctagagtctgagcccatacaccaggaatctccagca
agaagtagtcctgaactactgccttctggtgtgactgatgaaaatgaggtgactacagct
gttactgaaaaagtttgttctgaactcgacaataatagacattcaaaagaggaagatcca
tttaatgtagactcaagttcgctgacaggtccagttgcagatacaaacttggattttttc
cagtctgatccttttgttggcagtgatcctttcaaggatgatccttttggaaaaatcgat
ccatttggtggtgatcctttcaaaggttcagatccatttgcatcagactgtttcttcagg
caatctactgatccttttgccacttcaagcactgaccctttcagtgcagccaacaatagc
agtattacatcggtagaaacgttgaagcacaatgatccttttgctcctggtggaacagtt
gttgcagcaagcgattcagccacagacccctttgcttctgtttttgggaatgaatcattt
ggaggtggatttgctgacttcagcacattgtcaaaggtcaacaatgaagatccttttcgt
tcagccacatcgagctctgtcagcaacgtagtgattacaaaaaatgtatttgaggaaaca
tcggtcaaaagtgaagatgaacccccagcactgccaccaaagatcggaactccaacaaga
ccctgccctctaccacctgggaaaagatccatcaacaaattggattctcctgatcccttt
aaactgaatgatccatttcagcctttcccaggcaacgatagccccaaagaaaaagatcct
gaaatattttgtgatccattcacttctgctactaccactaccaataaagaggctgatcca
agcaattttgccaacttcagtgcttatccctctgaagaagatatgatcgaatgggccaag
agggaaagtgagagagaggaagagcagaggcttgcccgactaaatcagcaggaacaagaa
gacttagaactggctattgcactcagcaaatctgagatatcagaagcatga

KEGG   Homo sapiens (human): 58513
Entry
58513             CDS       T01001                                 
Symbol
EPS15L1, EPS15R
Name
(RefSeq) epidermal growth factor receptor pathway substrate 15 like 1
  KO
K12472  epidermal growth factor receptor substrate 15
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    58513 (EPS15L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    58513 (EPS15L1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    58513 (EPS15L1)
SSDB
Motif
Pfam: EF-hand_4 EF-hand_1 EF-hand_6 EF-hand_7 Crescentin EF-hand_8 CALCOCO1 ATG16 EF-hand_9 EzrA IFT57 DUF745 EF-hand_5 LMBR1 Tropomyosin MscS_porin Fez1 DUF16 MPS2 WEMBL DUF4763 MAD Prominin BicD DUF4201 TPR_MLP1_2 HMMR_N
Other DBs
NCBI-GeneID: 58513
NCBI-ProteinID: NP_067058
OMIM: 616826
HGNC: 24634
Ensembl: ENSG00000127527
Pharos: Q9UBC2(Tbio)
UniProt: Q9UBC2
LinkDB
Position
19:complement(16355247..16472012)
AA seq 864 aa
MAAPLIPLSQQIPTGNSLYESYYKQVDPAYTGRVGASEAALFLKKSGLSDIILGKIWDLA
DPEGKGFLDKQGFYVALRLVACAQSGHEVTLSNLNLSMPPPKFHDTSSPLMVTPPSAEAH
WAVRVEEKAKFDGIFESLLPINGLLSGDKVKPVLMNSKLPLDVLGRVWDLSDIDKDGHLD
RDEFAVAMHLVYRALEKEPVPSALPPSLIPPSKRKKTVFPGAVPVLPASPPPKDSLRSTP
SHGSVSSLNSTGSLSPKHSLKQTQPTVNWVVPVADKMRFDEIFLKTDLDLDGYVSGQEVK
EIFMHSGLTQNLLAHIWALADTRQTGKLSKDQFALAMYFIQQKVSKGIDPPQVLSPDMVP
PSERGTPGPDSSGSLGSGEFTGVKELDDISQEIAQLQREKYSLEQDIREKEEAIRQKTSE
VQELQNDLDRETSSLQELEAQKQDAQDRLDEMDQQKAKLRDMLSDVRQKCQDETQMISSL
KTQIQSQESDLKSQEDDLNRAKSELNRLQQEETQLEQSIQAGRVQLETIIKSLKSTQDEI
NQARSKLSQLHESRQEAHRSLEQYDQVLDGAHGASLTDLANLSEGVSLAERGSFGAMDDP
FKNKALLFSNNTQELHPDPFQTEDPFKSDPFKGADPFKGDPFQNDPFAEQQTTSTDPFGG
DPFKESDPFRGSATDDFFKKQTKNDPFTSDPFTKNPSLPSKLDPFESSDPFSSSSVSSKG
SDPFGTLDPFGSGSFNSAEGFADFSQMSKPPPSGPFTSSLGGAGFSDDPFKSKQDTPALP
PKKPAPPRPKPPSGKSTPVSQLGSADFPEAPDPFQPLGADSGDPFQSKKGFGDPFSGKDP
FVPSSAAKPSKASASGFADFTSVS
NT seq 2595 nt   +upstreamnt  +downstreamnt
atggcggcgccgctcatccccctctcccagcagattcccactggaaattcgttgtatgaa
tcttattacaagcaggtcgatccggcatacacagggagggtgggggcgagtgaagctgcg
ctttttctaaagaagtctggcctctcggacattatccttgggaagatatgggacttggcc
gatccagaaggtaaagggttcttggacaaacagggtttctatgttgcactgagactggtg
gcctgtgcacagagtggccatgaagttaccttgagcaatctgaatttgagcatgccaccg
cctaaatttcacgacaccagcagccctctgatggtcacaccgccctctgcagaggcccac
tgggctgtgagggtggaagaaaaggccaaatttgatgggatttttgaaagcctcttgccc
atcaatggtttgctctctggagacaaagtcaagccagtcctcatgaactcaaagctgcct
cttgatgtcctgggcagggtctgggacctcagtgacattgacaaggatgggcacttggat
cgagatgagttcgctgtggccatgcacttggtgtaccgagccctggagaaggagcccgtg
ccctccgccctgcccccgtccctcatcccaccctccaagagaaagaagactgtgttccct
ggcgccgtccccgtcctgcctgccagccccccaccaaaagacagcctccgctccacgccg
tcccacggcagcgtcagcagcctcaacagcacagggagcctgtcccccaagcacagcctc
aagcaaacacagccaacagtgaactgggtggtgcccgtggcagacaagatgcgatttgat
gagatattcctgaagaccgacctggacctggatggctacgtgagtggccaggaggtgaag
gagatcttcatgcactcgggcctcacccagaaccttctagcacacatatgggccctggcc
gatacgaggcaaacggggaagttaagcaaagaccaattcgcgttagctatgtatttcatt
cagcagaaggtcagtaaaggcatcgaccctcctcaagtcctctcgccggacatggtcccg
ccttcggagagaggcacgcccggcccggacagttcaggctctctcggctccggggagttt
actggcgtgaaggagcttgatgacatcagtcaagagattgcccagttacaaagagagaaa
tattcactggaacaagacattcgagaaaaggaagaggcaatcagacagaaaaccagcgag
gtgcaggaattacaaaatgacctagaccgggaaacaagcagtttgcaggagctcgaggct
cagaaacaggatgctcaagaccgcctggacgagatggaccagcagaaggccaagctccga
gacatgctgagcgacgtccggcagaagtgccaggatgagactcagatgatctcatcactg
aaaacgcaaatccaatctcaggaatctgacttaaagtcccaggaagacgatctgaaccga
gccaagtcggagctgaaccgattgcagcaggaggaaacccagctggagcagagcattcag
gctgggcgagtccagctggaaaccatcatcaagtccctgaagtcaacgcaagacgaaatc
aaccaggcaaggagcaaactttcccagctgcatgaaagccgccaggaggcccacaggagc
ctggagcagtatgaccaggtgctcgatggagcccatggtgccagcctgaccgacctggcc
aacctgagcgaaggcgtctccctggcagagaggggcagttttggagccatggatgatcct
ttcaaaaataaagccttgttatttagcaacaacacgcaagagttgcatccggatcctttc
cagacagaagaccccttcaaatctgacccatttaaaggagctgaccccttcaaaggcgac
ccgttccagaatgacccctttgcagaacagcagacaacttcaacagatccatttggaggg
gaccctttcaaagaaagtgacccattccgtggctctgccactgacgacttcttcaagaaa
cagacaaagaatgacccatttacctcggatccattcacgaaaaacccttccttaccttcg
aagctcgacccctttgaatccagtgatcccttttcatcctccagtgtctcctcaaaagga
tcagatccctttggaaccttagatcccttcggaagtgggtccttcaatagtgctgaaggc
tttgccgacttcagccagatgtccaagcccccaccttctggccctttcacctcctccttg
ggaggggcaggattctcagatgacccctttaaaagtaaacaggacactcctgctctgcct
ccgaagaaacctgctcctccacggcctaaaccgcccagcggtaaaagtacacctgtaagc
cagcttggttccgcagactttcccgaggcccccgatccattccagccactcggggctgac
agcggcgacccgttccaaagtaaaaaggggtttggggacccgtttagtggaaaagaccca
tttgtcccctcctctgcagctaaaccttctaaggcctctgcctcgggctttgcagacttc
acctctgtaagttga

DBGET integrated database retrieval system