KEGG   Homo sapiens (human): 2151
Entry
2151              CDS       T01001                                 

Symbol
F2RL2, PAR-3, PAR3
Name
(RefSeq) coagulation factor II thrombin receptor like 2
  KO
K04235  coagulation factor II (thrombin) receptor-like 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2151 (F2RL2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    2151 (F2RL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2151 (F2RL2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Thrombin
    2151 (F2RL2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 2151
NCBI-ProteinID: NP_004092
OMIM: 601919
HGNC: 3539
Ensembl: ENSG00000164220
Vega: OTTHUMG00000102119
Pharos: O00254(Tbio)
UniProt: O00254
LinkDB
Position
5q13.3
AA seq 374 aa
MKALIFAAAGLLLLLPTFCQSGMENDTNNLAKPTLPIKTFRGAPPNSFEEFPFSALEGWT
GATITVKIKCPEESASHLHVKNATMGYLTSSLSTKLIPAIYLLVFVVGVPANAVTLWMLF
FRTRSICTTVFYTNLAIADFLFCVTLPFKIAYHLNGNNWVFGEVLCRATTVIFYGNMYCS
ILLLACISINRYLAIVHPFTYRGLPKHTYALVTCGLVWATVFLYMLPFFILKQEYYLVQP
DITTCHDVHNTCESSSPFQLYYFISLAFFGFLIPFVLIIYCYAAIIRTLNAYDHRWLWYV
KASLLILVIFTICFAPSNIILIIHHANYYYNNTDGLYFIYLIALCLGSLNSCLDPFLYFL
MSKTRNHSTAYLTK
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgaaagccctcatctttgcagctgctggcctcctgcttctgttgcccactttttgtcag
agtggcatggaaaatgatacaaacaacttggcaaagccaaccttacccattaagaccttt
cgtggagctcccccaaattcttttgaagagttccccttttctgccttggaaggctggaca
ggagccacgattactgtaaaaattaagtgccctgaagaaagtgcttcacatctccatgtg
aaaaatgctaccatggggtacctgaccagctccttaagtactaaactgatacctgccatc
tacctcctggtgtttgtagttggtgtcccggccaatgctgtgaccctgtggatgcttttc
ttcaggaccagatccatctgtaccactgtattctacaccaacctggccattgcagatttt
cttttttgtgttacattgccctttaagatagcttatcatctcaatgggaacaactgggta
tttggagaggtcctgtgccgggccaccacagtcatcttctatggcaacatgtactgctcc
attctgctccttgcctgcatcagcatcaaccgctacctggccatcgtccatcctttcacc
taccggggcctgcccaagcacacctatgccttggtaacatgtggactggtgtgggcaaca
gttttcttatatatgctgccatttttcatactgaagcaggaatattatcttgttcagcca
gacatcaccacctgccatgatgttcacaacacttgcgagtcctcatctcccttccaactc
tattacttcatctccttggcattctttggattcttaattccatttgtgcttatcatctac
tgctatgcagccatcatccggacacttaatgcatacgatcatagatggttgtggtatgtt
aaggcgagtctcctcatccttgtgatttttaccatttgctttgctccaagcaatattatt
cttattattcaccatgctaactactactacaacaacactgatggcttatattttatatat
ctcatagctttgtgcctgggtagtcttaatagttgcttagatccattcctttattttctc
atgtcaaaaaccagaaatcactccactgcttaccttacaaaatag

KEGG   Homo sapiens (human): 9002
Entry
9002              CDS       T01001                                 

Symbol
F2RL3, PAR4
Name
(RefSeq) F2R like thrombin or trypsin receptor 3
  KO
K04236  coagulation factor II (thrombin) receptor-like 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
hsa04611  Platelet activation
hsa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    9002 (F2RL3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9002 (F2RL3)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    9002 (F2RL3)
   04611 Platelet activation
    9002 (F2RL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9002 (F2RL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9002 (F2RL3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Thrombin
    9002 (F2RL3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 9002
NCBI-ProteinID: NP_003941
OMIM: 602779
HGNC: 3540
Ensembl: ENSG00000127533
Vega: OTTHUMG00000182647
Pharos: Q96RI0(Tchem)
UniProt: Q96RI0
LinkDB
Position
19p13.11
AA seq 385 aa
MWGRLLLWPLVLGFSLSGGTQTPSVYDESGSTGGGDDSTPSILPAPRGYPGQVCANDSDT
LELPDSSRALLLGWVPTRLVPALYGLVLVVGLPANGLALWVLATQAPRLPSTMLLMNLAA
ADLLLALALPPRIAYHLRGQRWPFGEAACRLATAALYGHMYGSVLLLAAVSLDRYLALVH
PLRARALRGRRLALGLCMAAWLMAAALALPLTLQRQTFRLARSDRVLCHDALPLDAQASH
WQPAFTCLALLGCFLPLLAMLLCYGATLHTLAASGRRYGHALRLTAVVLASAVAFFVPSN
LLLLLHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDKVRAGLFQRSP
GDTVASKASAEGGSRGMGTHSSLLQ
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgtgggggcgactgctcctgtggcccctggtgctggggttcagcctgtctggcggcacc
cagacccccagcgtctacgacgagagcgggagcaccggaggtggtgatgacagcacgccc
tcaatcctgcctgccccccgcggctacccaggccaagtctgtgccaatgacagtgacacc
ctggagctcccggacagctcacgggcactgcttctgggctgggtgcccaccaggctggtg
cccgccctctatgggctggtcctggtggtggggctgccggccaatgggctggcgctgtgg
gtgctggccacgcaggcacctcggctgccctccaccatgctgctgatgaacctcgcggct
gctgacctcctgctggccctggcgctgcccccgcggatcgcctaccacctgcgtggccag
cgctggcccttcggggaggccgcctgccgcctggccacggccgcactctatggtcacatg
tatggctcagtgctgctgctggccgccgtcagcctggatcgctacctggccctggtgcac
ccgctgcgggcccgcgccctgcgtggccggcgcctggcccttggactctgcatggctgct
tggctcatggcggccgccctggcactgcccctgacactgcagcggcagaccttccggctg
gcgcgctccgatcgcgtgctctgccatgacgcgctgcccctggacgcacaggcctcccac
tggcaaccggccttcacctgcctggcgctgttgggctgtttcctgcccctgctggccatg
ctgctgtgctacggggccaccctgcacacgctggcggccagcggccggcgctacggccac
gcgctgaggctgaccgcagtggtgctggcctccgccgtggccttcttcgtgcccagcaac
ctgctgctgctgctgcattactcggacccgagccccagcgcctggggcaacctctatggt
gcctacgtgcccagcctggcgctgagcaccctcaacagctgcgtggatcccttcatctac
tactacgtgtcggccgagttcagggacaaggtgcgggcagggctcttccaacggtcgccg
ggggacaccgtggcctccaaggcctctgcggaagggggcagccggggcatgggcacccac
tcctctttgctccagtga

DBGET integrated database retrieval system