KEGG   Homo sapiens (human): 221613
Entry
221613            CDS       T01001                                 
Symbol
H2AC1, H2AA, H2AFR, HIST1H2AA, HISTH2AA, TH2A, bA317E16.2
Name
(RefSeq) H2A clustered histone 1
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    221613 (H2AC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    221613 (H2AC1)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    221613 (H2AC1)
  09165 Substance dependence
   05034 Alcoholism
    221613 (H2AC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    221613 (H2AC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    221613 (H2AC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    221613 (H2AC1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   221613 (H2AC1)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 221613
NCBI-ProteinID: NP_734466
OMIM: 613499
HGNC: 18729
Ensembl: ENSG00000164508
Pharos: Q96QV6(Tdark)
UniProt: Q96QV6
Structure
LinkDB
Position
6:complement(25726063..25726562)
AA seq 131 aa
MSGRGKQGGKARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLT
AEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TESHHHKAQSK
NT seq 396 nt   +upstreamnt  +downstreamnt
atgtctggacgagggaagcagggaggaaaagcacgcgccaagtctaagtctcgctcttct
agagcgggtttgcagtttcccgtaggccggatccatcgtctgcttcgtaagggaaactat
gcagagcggataggggcaggcgcaccagtgtatttggcggcagtgttagagtatctcaca
gcagaaatccttgagctggcaggcaatgcgtctcgcgataacaaaaaaactcgcattatt
ccccgccacctgcagctagcgatccgcaatgatgaggaactcaataagcttttgggcggc
gtgaccattgcccagggcggagtcctgcctaacattcaggcagtgctgctgcccaagaag
actgagagtcaccaccataaagcccaaagcaagtaa

KEGG   Homo sapiens (human): 3012
Entry
3012              CDS       T01001                                 
Symbol
H2AC8, H2A.1, H2A.2, H2A/a, H2AC4, H2AFA, HIST1H2AE
Name
(RefSeq) H2A clustered histone 8
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3012 (H2AC8)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    3012 (H2AC8)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3012 (H2AC8)
  09165 Substance dependence
   05034 Alcoholism
    3012 (H2AC8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3012 (H2AC8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3012 (H2AC8)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3012 (H2AC8)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3012 (H2AC8)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 3012
NCBI-ProteinID: NP_066390
OMIM: 602786
HGNC: 4724
Ensembl: ENSG00000277075
UniProt: P04908 Q08AJ9
Structure
LinkDB
Position
6:26216921..26217437
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggacgtggaaagcaaggcggcaaagctcgggcaaaagctaaaacgcgttcttcc
agggccggtcttcagtttccagttggccgtgtgcaccgcctcctccgcaaaggcaactac
tccgaacgagtcggggccggcgctccagtgtacctggcagcggtgctggaatatctgacg
gccgagatcttagagctagctggcaacgcggctcgcgacaataagaagacccgcatcatc
ccgcgccacctgcagctagccatccgcaacgacgaggagctaaataagcttctaggtcgc
gtgaccatcgcgcagggcggtgtcctgcccaacatccaggccgtattgctgcctaagaag
acggagagccaccataaggccaagggcaagtga

KEGG   Homo sapiens (human): 3013
Entry
3013              CDS       T01001                                 
Symbol
H2AC7, H2A.3, H2A/g, H2AFG, HIST1H2AD
Name
(RefSeq) H2A clustered histone 7
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3013 (H2AC7)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    3013 (H2AC7)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3013 (H2AC7)
  09165 Substance dependence
   05034 Alcoholism
    3013 (H2AC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3013 (H2AC7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3013 (H2AC7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3013 (H2AC7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3013 (H2AC7)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 3013
NCBI-ProteinID: NP_066409
OMIM: 602792
HGNC: 4729
Ensembl: ENSG00000196866
Pharos: P20671(Tdark)
UniProt: P20671 B2R5B6
Structure
LinkDB
Position
6:complement(26198784..26199293)
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtccggacgcggcaagcaaggcggaaaggcccgagctaaggctaagacccgctcttcg
cgggccggactccagttccctgtgggccgcgtacaccgcttgctccgcaagggcaactac
tccgagcgagtcggggccggcgcgccagtgtatctggcggcggtgttggagtacctgacc
gccgagatcctggagctggcgggcaacgccgcccgcgacaacaagaagacccgcatcatc
ccccgacacctgcagctggccatccgcaacgacgaggagctaaacaagttgctgggtaaa
gtcacaattgctcagggcggtgttctgcccaacatccaggctgtactgctccccaagaag
actgagagtcaccacaaggccaagggcaagtaa

KEGG   Homo sapiens (human): 3014
Entry
3014              CDS       T01001                                 
Symbol
H2AX, H2A.X, H2A/X, H2AFX
Name
(RefSeq) H2A.X variant histone
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Network
nt06506  Double-strand break repair
  Element
N01439  Double-strand break signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3014 (H2AX)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    3014 (H2AX)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3014 (H2AX)
  09165 Substance dependence
   05034 Alcoholism
    3014 (H2AX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3014 (H2AX)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3014 (H2AX)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3014 (H2AX)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3014 (H2AX)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 3014
NCBI-ProteinID: NP_002096
OMIM: 601772
HGNC: 4739
Ensembl: ENSG00000188486
Pharos: P16104(Tbio)
UniProt: P16104
Structure
LinkDB
Position
11:complement(119093874..119095465)
AA seq 143 aa
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TSATVGPKAPSGGKKATQASQEY
NT seq 432 nt   +upstreamnt  +downstreamnt
atgtcgggccgcggcaagactggcggcaaggcccgcgccaaggccaagtcgcgctcgtcg
cgcgccggcctccagttcccagtgggccgtgtacaccggctgctgcggaagggccactac
gccgagcgcgttggcgccggcgcgccagtgtacctggcggcagtgctggagtacctcacc
gctgagatcctggagctggcgggcaatgcggcccgcgacaacaagaagacgcgaatcatc
ccccgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcggc
gtgacgatcgcccagggaggcgtcctgcccaacatccaggccgtgctgctgcccaagaag
accagcgccaccgtggggccgaaggcgccctcgggcggcaagaaggccacccaggcctcc
caggagtactaa

KEGG   Homo sapiens (human): 3015
Entry
3015              CDS       T01001                                 
Symbol
H2AZ1, H2A.Z-1, H2A.z, H2A/z, H2AFZ, H2AZ
Name
(RefSeq) H2A.Z variant histone 1
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3015 (H2AZ1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    3015 (H2AZ1)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3015 (H2AZ1)
  09165 Substance dependence
   05034 Alcoholism
    3015 (H2AZ1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3015 (H2AZ1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3015 (H2AZ1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3015 (H2AZ1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3015 (H2AZ1)
SSDB
Motif
Pfam: Histone Histone_H2A_C CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 3015
NCBI-ProteinID: NP_002097
OMIM: 142763
HGNC: 4741
Ensembl: ENSG00000164032
Pharos: P0C0S5(Tbio)
UniProt: P0C0S5
Structure
LinkDB
Position
4:complement(99948088..99950275)
AA seq 128 aa
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTV
NT seq 387 nt   +upstreamnt  +downstreamnt
atggctggcggtaaggctggaaaggactccggaaaggccaagacaaaggcggtttcccgc
tcgcagagagccggcttgcagttcccagtgggccgtattcatcgacacctaaaatctagg
acgaccagtcatggacgtgtgggcgcgactgccgctgtgtacagcgcagccatcctggag
tacctcaccgcagaggtacttgaactggcaggaaatgcatcaaaagacttaaaggtaaag
cgtattacccctcgtcacttgcaacttgctattcgtggagatgaagaattggattctctc
atcaaggctacaattgctggtggtggtgtcattccacacatccacaaatctctgattggg
aagaaaggacaacagaagactgtctaa

KEGG   Homo sapiens (human): 317772
Entry
317772            CDS       T01001                                 
Symbol
H2AC21, H2AB, HIST2H2AB
Name
(RefSeq) H2A clustered histone 21
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    317772 (H2AC21)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    317772 (H2AC21)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    317772 (H2AC21)
  09165 Substance dependence
   05034 Alcoholism
    317772 (H2AC21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    317772 (H2AC21)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    317772 (H2AC21)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    317772 (H2AC21)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   317772 (H2AC21)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 317772
NCBI-ProteinID: NP_778235
OMIM: 615014
HGNC: 20508
Ensembl: ENSG00000184270
Pharos: Q8IUE6(Tdark)
UniProt: Q8IUE6
LinkDB
Position
1:complement(149887469..149887965)
AA seq 130 aa
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TESHKPGKNK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtcaggacgcggaaagcagggaggcaaggcccgcgctaaggccaagtcgcgctcgtcc
cgcgctggtctccagttcccggtggggcgagtgcaccgcttgctgcgcaaaggcaactac
gcggagcgggtcggggcaggcgccccggtgtacctggcggcggtcctcgagtacctgacc
gcggaaattctggagctggcgggcaacgcggctcgggacaacaagaagacgcgcatcatc
cctcgccatctgcaactagccgtgaggaatgacgaagagctcaacaagttactcgggggt
gtcaccattgcccagggcggcgtcttgcccaatatccaggctgtcctgttgcccaagaaa
acggagagtcacaagcctggcaagaacaagtaa

KEGG   Homo sapiens (human): 474381
Entry
474381            CDS       T01001                                 
Symbol
H2AB2, H2A.B.1, H2A.Bbd, H2AB3, H2AFB2
Name
(RefSeq) H2A.B variant histone 2
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    474381 (H2AB2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    474381 (H2AB2)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    474381 (H2AB2)
  09165 Substance dependence
   05034 Alcoholism
    474381 (H2AB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    474381 (H2AB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    474381 (H2AB2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    474381 (H2AB2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   474381 (H2AB2)
SSDB
Motif
Pfam: Histone
Other DBs
NCBI-GeneID: 474381
NCBI-ProteinID: NP_001017991
OMIM: 301038
HGNC: 18298
Ensembl: ENSG00000277858
UniProt: P0C5Z0
Structure
LinkDB
Position
X:155380709..155381299
AA seq 115 aa
MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVI
EYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
NT seq 348 nt   +upstreamnt  +downstreamnt
atgccgaggaggaggagacgccgagggtcctccggtgctggcggccgggggcggacctgc
tctcgcaccgtccgagcggagctttcgttttcagtgagccaggtggagcgcagtctacgg
gagggccactacgctcagcgcctgagtcgcacggcgccggtctacctcgctgcggttatt
gagtacctgacggccaaggtcctggagctggcgggcaacgaggcccagaacagcggagag
cggaacatcactcccctgctgctggacatggtggttcacaacgacaggctactgagcacc
cttttcaacacgaccaccatctctcaagtggcccctggcgaggactag

KEGG   Homo sapiens (human): 474382
Entry
474382            CDS       T01001                                 
Symbol
H2AB1, H2A.B, H2A.B.2, H2A.Bbd, H2AFB1
Name
(RefSeq) H2A.B variant histone 1
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    474382 (H2AB1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    474382 (H2AB1)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    474382 (H2AB1)
  09165 Substance dependence
   05034 Alcoholism
    474382 (H2AB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    474382 (H2AB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    474382 (H2AB1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    474382 (H2AB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   474382 (H2AB1)
SSDB
Motif
Pfam: Histone
Other DBs
NCBI-GeneID: 474382
NCBI-ProteinID: NP_001017990
OMIM: 301037
HGNC: 22516
Ensembl: ENSG00000274183
Pharos: P0C5Y9(Tdark)
UniProt: P0C5Y9
LinkDB
Position
X:154884972..154885558
AA seq 115 aa
MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVI
EYLTAKVPELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
NT seq 348 nt   +upstreamnt  +downstreamnt
atgccgaggaggaggagacgccgagggtcctccggtgctggcggccgggggcggacctgc
tctcgcaccgtccgagcggagctttcgttttcagtgagccaggtggagcgcagtctacgg
gagggccactacgctcagcgcctgagtcgcacggcgccggtctacctcgctgcggttatt
gagtacctgacggccaaggtcccggagctggcgggcaacgaggcccagaacagcggagag
cggaacatcactcccctgctgctggacatggtggttcacaacgacaggctactgagcacc
cttttcaacacgaccaccatctctcaagtggcccctggcgaggactag

KEGG   Homo sapiens (human): 55506
Entry
55506             CDS       T01001                                 
Symbol
MACROH2A2, H2AFY2
Name
(RefSeq) macroH2A.2 histone
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    55506 (MACROH2A2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    55506 (MACROH2A2)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    55506 (MACROH2A2)
  09165 Substance dependence
   05034 Alcoholism
    55506 (MACROH2A2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    55506 (MACROH2A2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    55506 (MACROH2A2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    55506 (MACROH2A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   55506 (MACROH2A2)
SSDB
Motif
Pfam: Macro Histone_H2A_C Histone CBFD_NFYB_HMF DUF1764 Clp_N
Other DBs
NCBI-GeneID: 55506
NCBI-ProteinID: NP_061119
OMIM: 616141
HGNC: 14453
Ensembl: ENSG00000099284
Pharos: Q9P0M6(Tbio)
UniProt: Q9P0M6 A0A024QZP6
Structure
LinkDB
Position
10:70052846..70112282
AA seq 372 aa
MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEI
LELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGT
KGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPG
DGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKE
FLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSA
AEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIG
IYVQEMAKLDAK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtcgggccggagtgggaagaagaaaatgtccaagctgtcccgttcagctagggcaggt
gtcatctttccagtggggaggctgatgcgttatctgaagaaagggacgttcaagtaccgg
atcagcgtgggcgcccctgtctacatggcggcagtcattgagtacctggcagcggaaatt
ctagaattggccggcaatgccgcgagggacaacaagaaggcccggatagccccgagacac
atcttgctggcagttgccaatgacgaggagctcaaccagctgctaaaaggagtgaccatc
gccagtggaggcgtcctgcccagaattcaccccgaactgctggccaaaaagcgagggacc
aaaggcaagtcggaaacgatcctctccccacccccagagaaaagaggcaggaaggccacg
tcaggcaagaagggggggaagaaatccaaggctgccaaaccacggacgtccaaaaagtcc
aaaccaaaggacagcgataaagaaggaacttcaaattccacctctgaagatgggccaggg
gatggattcaccattctgtcttctaagagccttgttctgggacagaagctgtccttaacc
cagagtgacatcagccatattggctccatgagagtggagggcattgtccacccaaccaca
gccgaaattgacctcaaagaagatataggtaaagccttggaaaaggctgggggaaaagag
ttcttggaaacggtaaaggagcttcgcaaatcccaaggccctttggaagtcgccgaagcc
gccgtcagccaatccagtggactcgcagccaaatttgtcatccactgtcacatccctcag
tggggctccgacaaatgtgaagaacagcttgaagagaccatcaaaaactgcctgtcagcg
gcggaggacaagaagctaaagtccgtcgcgttcccgcctttccccagcggcagaaactgc
tttcccaaacagactgcggcccaggtgaccctcaaagccatctcagcccactttgatgac
tcgagcgcgtcctcgctgaagaacgtgtacttcctgctcttcgacagcgagagcatcggc
atctacgtgcaggagatggccaagctcgacgccaagtag

KEGG   Homo sapiens (human): 55766
Entry
55766             CDS       T01001                                 
Symbol
H2AJ, H2AFJ
Name
(RefSeq) H2A.J histone
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04613  Neutrophil extracellular trap formation
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    55766 (H2AJ)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    55766 (H2AJ)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    55766 (H2AJ)
  09165 Substance dependence
   05034 Alcoholism
    55766 (H2AJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    55766 (H2AJ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    55766 (H2AJ)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    55766 (H2AJ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   55766 (H2AJ)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 55766
NCBI-ProteinID: NP_808760
HGNC: 14456
Ensembl: ENSG00000246705
Pharos: Q9BTM1(Tbio)
UniProt: Q9BTM1 A0A024RAS2
Structure
LinkDB
Position
12:14774405..14778002
AA seq 129 aa
MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESQKTKSK
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtccggtcgcgggaaacagggcggcaaagtgcgagcaaaggccaaatcccgctcctcc
cgcgcgggcctgcagttcccggtgggccgagtgcacagactgctgcgcaaagggaactac
gcggagcgagtgggcgccggggcgccggtgtacctggcggcggtgttggagtaccttacg
gcggagatcctggagctggctggcaacgccgcgcgtgacaacaagaagaccaggataatt
ccccgccacctgcagctcgccatccgcaacgacgaggagttaaacaagctgctgggcaaa
gtgaccatcgctcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag
acggagagtcagaagacgaagagcaaatga

DBGET integrated database retrieval system