KEGG   Homo sapiens (human): 22876
Entry
22876             CDS       T01001                                 
Symbol
INPP5F, MSTP007, MSTPO47, SAC2, hSAC2
Name
(RefSeq) inositol polyphosphate-5-phosphatase F
  KO
K21798  phosphatidylinositol 4-phosphatase [EC:3.1.3.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    22876 (INPP5F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    22876 (INPP5F)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-
     22876 (INPP5F)
SSDB
Motif
Pfam: Syja_N hSac2 EST1
Other DBs
NCBI-GeneID: 22876
NCBI-ProteinID: NP_055752
OMIM: 609389
HGNC: 17054
Ensembl: ENSG00000198825
Vega: OTTHUMG00000019158
Pharos: Q9Y2H2(Tbio)
UniProt: Q9Y2H2
Structure
LinkDB
Position
10:119726050..119829147
AA seq 1132 aa
MELFQAKDHYILQQGERALWCSRRDGGLQLRPATDLLLAWNPICLGLVEGVIGKIQLHSD
LPWWLILIRQKALVGKLPGDHEVCKVTKIAVLSLSEMEPQDLELELCKKHHFGINKPEKI
IPSPDDSKFLLKTFTHIKSNVSAPNKKKVKESKEKEKLERRLLEELLKMFMDSESFYYSL
TYDLTNSVQRQSTGERDGRPLWQKVDDRFFWNKYMIQDLTEIGTPDVDFWIIPMIQGFVQ
IEELVVNYTESSDDEKSSPETPPQESTCVDDIHPRFLVALISRRSRHRAGMRYKRRGVDK
NGNVANYVETEQLIHVHNHTLSFVQTRGSVPVFWSQVGYRYNPRPRLDRSEKETVAYFCA
HFEEQLNIYKKQVIINLVDQAGREKIIGDAYLKQVLLFNNSHLTYVSFDFHEHCRGMKFE
NVQTLTDAIYDIILDMKWCWVDEAGVICKQEGIFRVNCMDCLDRTNVVQAAIARVVMEQQ
LKKLGVMPPEQPLPVKCNRIYQIMWANNGDSISRQYAGTAALKGDFTRTGERKLAGVMKD
GVNSANRYYLNRFKDAYRQAVIDLMQGIPVTEDLYSIFTKEKEHEALHKENQRSHQELIS
QLLQSYMKLLLPDDEKFHGGWALIDCDPSLIDATHRDVDVLLLLSNSAYYVAYYDDEVDK
VNQYQRLSLENLEKIEIGPEPTLFGKPKFSCMRLHYRYKEASGYFHTLRAVMRNPEEDGK
DTLQCIAEMLQITKQAMGSDLPIIEKKLERKSSKPHEDIIGIRSQNQGSLAQGKNFLMSK
FSSLNQKVKQTKSNVNIGNLRKLGNFTKPEMKVNFLKPNLKVNLWKSDSSLETMENTGVM
DKVQAESDGDMSSDNDSYHSDEFLTNSKSDEDRQLANSLESVGPIDYVLPSCGIIASAPR
LGSRSQSLSSTDSSVHAPSEITVAHGSGLGKGQESPLKKSPSAGDVHILTGFAKPMDIYC
HRFVQDAQNKVTHLSETRSVSQQASQERNQMTNQVSNETQSESTEQTPSRPSQLDVSLSA
TGPQFLSVEPAHSVASQKTPTSASSMLELETGLHVTPSPSESSSSRAVSPFAKIRSSMVQ
VASITQAGLTHGINFAVSKVQKSPPEPEIINQVQQNELKKMFIQCQTRIIQI
NT seq 3399 nt   +upstreamnt  +downstreamnt
atggagctcttccaagccaaggaccactacatcctgcagcagggcgagcgcgcgctgtgg
tgcagccgccgcgacggcggcctccagctccgacccgctactgatctacttcttgcctgg
aatcccatttgtttggggttggtagaaggtgttattgggaaaattcaacttcattcagat
cttccatggtggcttattctaattcggcagaaagcattggtgggcaaactcccaggagac
catgaggtctgtaaagttaccaaaattgctgtgctctcactttctgaaatggaacctcag
gatcttgagctagagctctgtaagaagcatcattttggtattaacaaaccagagaagatc
ataccatctcctgatgactcaaagtttctactgaagacctttacgcatattaaatccaat
gtgtctgctcctaataaaaagaaagttaaggaaagtaaagagaaggagaagttggagagg
agattacttgaagagttgctgaagatgttcatggactcagaatccttttattatagcttg
acctatgacctgaccaattccgtgcagaggcagagcactggggagagggacggtcggccc
ctctggcagaaggttgatgaccgatttttttggaataaatacatgatacaagatcttact
gagattggtactccagatgtggacttttggattatccccatgatccaaggttttgtgcag
attgaagaacttgtggttaattataccgaatcatctgatgatgagaaaagcagcccagag
accccccctcaggagtccacctgtgtagatgatattcacccacgatttctagtggctctc
atttcacgccgaagtaggcacagagcaggaatgcgctataaacgaagaggagtggataaa
aatggaaatgttgccaattatgtggagactgagcagttgattcatgttcataatcatacc
ctgtcatttgttcaaacacgaggctctgtgcctgtcttttggagccaggttgggtatcga
tataacccaagaccgcggctggacagaagtgaaaaggaaactgttgcctatttctgtgcc
catttcgaagaacaactgaacatttacaaaaaacaggttattattaacttggtagaccag
gcaggaagagagaagattattggcgatgcttacctgaagcaagtgttgcttttcaacaac
tcacacctcacttacgtttcgtttgacttccatgagcactgccgaggaatgaagtttgag
aatgttcagacactaacagatgccatttatgacattattcttgatatgaagtggtgttgg
gttgatgaagctggggtaatatgtaagcaggaagggatttttcgtgttaattgtatggac
tgcctggatcgcaccaacgtggtccaagctgccatcgcgagagtggtcatggaacagcag
ctgaaaaaattaggtgtgatgcccccggaacagccattacctgtgaaatgtaatcgcatc
taccagataatgtgggccaataatggtgactccattagcagacagtatgctgggacagct
gctctgaagggtgactttacaaggacaggagaaaggaagttagcaggagttatgaaagat
ggagtgaactcagcaaacagatattacctcaaccgatttaaggatgcttataggcaagct
gttatagatttgatgcaaggcattccagtgacagaagatctttattccatatttaccaag
gagaaagaacatgaagctttgcataaggaaaatcagagaagccaccaggaactaattagc
cagctcttacaaagttacatgaagttactactgcctgatgatgagaagttccatgggggc
tgggccctcattgactgtgaccctagcctcattgatgctactcacagagacgtggatgtg
ctgttactgctttctaactctgcctactacgtggcctattatgatgatgaagttgataaa
gtaaaccagtatcaacgactaagtctagaaaacctggaaaaaattgaaataggccctgaa
cccactctttttggtaagccaaagttctcctgcatgcgactgcactacagatacaaagaa
gcgagtggctatttccacacattgcgagctgtaatgcgtaatcctgaagaggatggaaaa
gatacccttcagtgcattgcagagatgctgcagatcaccaagcaagccatgggatcggat
ttacccataattgagaagaaacttgagaggaagagcagtaaacctcacgaagacatcatt
ggtatcaggtctcaaaaccaaggttctttggcccagggaaagaattttttaatgagcaaa
ttttcatctctaaatcaaaaagtgaagcagaccaaatccaatgtaaatattggcaacctc
cgaaagctaggaaactttaccaaacctgaaatgaaagttaactttctaaaaccaaactta
aaagtaaatctttggaaatcagatagtagtcttgaaactatggaaaacacaggagtgatg
gataaggttcaggcagagtctgatggggacatgtcttcagataatgactcataccactct
gatgaattccttacaaattctaagtctgatgaagacaggcagctagctaactcattagag
agtgtagggccaatagattacgttcttcctagttgtggtattattgcctcagcgcctcga
ttgggcagtcggtcccagtctcttagcagcacagatagtagcgttcatgctccttcagag
attactgttgctcatgggagtgggcttggaaaaggccaggagtctcctttgaagaaaagt
ccttctgctggcgacgtacacatattgactggctttgccaagcctatggatatttactgc
cacagatttgtgcaagatgcacagaacaaagtgacccacctatcagagaccagatctgtg
tctcagcaggctagtcaggaaagaaatcaaatgaccaatcaagtttcaaatgaaacccaa
tcagaatcaacagaacagacaccttctcggccatcgcaattagatgtctctctttctgca
acaggcccacagtttttgtcagttgagccagcgcattcagttgcatctcaaaaaaccccc
acctccgcttccagcatgcttgaacttgagacagggcttcatgtaactccttctccttca
gagagcagtagcagcagagcagtctctccctttgccaagattcgaagttccatggtccag
gttgctagtattacccaagctggattaacccatgggataaactttgcagtgtcaaaagtt
cagaagagtcctccagaacctgaaatcattaatcaagtccagcaaaatgaacttaaaaag
atgtttatacaatgccagacacggataattcagatttag

KEGG   Homo sapiens (human): 22908
Entry
22908             CDS       T01001                                 
Symbol
SACM1L, SAC1
Name
(RefSeq) SAC1 like phosphatidylinositide phosphatase
  KO
K21797  phosphatidylinositol 4-phosphatase [EC:3.1.3.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    22908 (SACM1L)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    22908 (SACM1L)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-
     22908 (SACM1L)
SSDB
Motif
Pfam: Syja_N DSS1_SEM1
Other DBs
NCBI-GeneID: 22908
NCBI-ProteinID: NP_054735
OMIM: 606569
HGNC: 17059
Ensembl: ENSG00000211456
Vega: OTTHUMG00000156653
Pharos: Q9NTJ5(Tbio)
UniProt: Q9NTJ5
LinkDB
Position
3:45689396..45745409
AA seq 587 aa
MATAAYEQLKLHITPEKFYVEACDDGADDVLTIDRVSTEVTLAVKKDVPPSAVTRPIFGI
LGTIHLVAGNYLIVITKKIKVGEFFSHVVWKATDFDVLSYKKTMLHLTDIQLQDNKTFLA
MLNHVLNVDGFYFSTTYDLTHTLQRLSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQP
EVHRFALPVLHGFITMHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVET
EQIVHYNGSKASFVQTRGSIPVFWSQRPNLKYKPLPQISKVANHMDGFQRHFDSQVIIYG
KQVIINLINQKGSEKPLEQTFATMVSSLGSGMMRYIAFDFHKECKNMRWDRLSILLDQVA
EMQDELSYFLVDSAGQVVANQEGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHV
GQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTHLGLIMDGWNSMIR
YYKNNFSDGFRQDSIDLFLGNYSVDELESHSPLSVPRDWKFLALPIIMVVAFSMCIICLL
MAGDTWTETLAYVLFWGVASIGTFFIILYNGKDFVDAPRLVQKEKID
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggcgacggcggcctacgagcagctgaagctgcatatcacacctgaaaaattttatgtg
gaagcttgtgatgatggagcagatgacgtacttaccattgaccgtgtgtccacagaggtt
acccttgcagtcaagaaagatgttcctccttcagctgtcacaagaccaatatttggtata
ctgggcacaatccatctggtggcaggtaattatcttatagtcattaccaaaaagataaaa
gtaggtgaatttttcagtcatgtagtctggaaagcaacagattttgatgtcctttcttat
aagaagacaatgttgcacttaactgatattcagttacaagataataaaaccttcctagcg
atgctaaaccatgtcttgaatgtggatggattttacttttcaacaacatatgatttgacc
catactttgcagcggctatccaacactagtcctgaattccaagaaatgagtctcttggaa
agggcagatcagcggtttgtatggaatggtcatcttctaagagaactttctgcacagcca
gaggttcatcggtttgcccttccagtgttacatggctttattaccatgcattcatgttct
attaatggaaaatactttgattggattctcatctcgaggaggagctgtttcagagctggt
gtgcgctattatgtaagaggaattgattcggaaggccatgcagctaactttgtagaaaca
gaacaaattgtgcactacaatgggagcaaagcttcgtttgtacagactcgaggatcaata
cctgttttctggtcccaaagaccaaacctcaagtacaaaccactgccacagatcagcaaa
gtagcaaatcacatggacggtttccaaaggcattttgattcccaagtaattatttatgga
aaacaagttataatcaatctgattaaccagaagggctcggagaagccacttgagcagaca
tttgcaacaatggtgtcttccttgggaagtggaatgatgagatacattgcctttgacttc
cataaggaatgtaaaaatatgagatgggatcgactaagtattttattggatcaggtagca
gaaatgcaagatgaattaagttattttctagtggactctgctggccaggtggtggcaaac
caggaaggcgtgttccgaagcaattgcatggattgtctagatagaaccaatgtgatccag
agtttgttagctcgtcgttcacttcaggcccaacttcagagactaggagttttgcatgtg
ggacaaaagcttgaagaacaagatgaatttgagaagatttacaaaaatgcctgggctgac
aacgcaaatgcttgtgccaagcaatatgcgggaactggtgccttgaagactgactttacc
agaactggaaagagaactcatttgggacttataatggatggctggaactcaatgatacga
tattataagaacaacttttccgatggatttagacaagattccatagacttatttcttgga
aactattcagtggatgaattagaatctcatagtcctttaagtgttccaagggactggaaa
ttcctggctttgcctattatcatggttgttgccttttcaatgtgcattatctgtttgctt
atggctggtgacacttggacagaaacactggcctatgtgctcttctggggagttgcaagc
attggaacattttttatcattctttacaatggcaaagattttgtcgatgctcccagactg
gtccagaaagaaaagatagactga

DBGET integrated database retrieval system