KEGG   Homo sapiens (human): 22916
Entry
22916             CDS       T01001                                 
Symbol
NCBP2, CBC2, CBP20, NIP1, PIG55
Name
(RefSeq) nuclear cap binding protein subunit 2
  KO
K12883  nuclear cap-binding protein subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
hsa03040  Spliceosome
Drug target
Obefazimod: D12345
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    22916 (NCBP2)
  09122 Translation
   03013 Nucleocytoplasmic transport
    22916 (NCBP2)
   03015 mRNA surveillance pathway
    22916 (NCBP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    22916 (NCBP2)
   03041 Spliceosome [BR:hsa03041]
    22916 (NCBP2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Cap binding complex
     22916 (NCBP2)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   Cap binding complex
    22916 (NCBP2)
SSDB
Motif
Pfam: RRM_1 RRM_occluded
Other DBs
NCBI-GeneID: 22916
NCBI-ProteinID: NP_031388
OMIM: 605133
HGNC: 7659
Ensembl: ENSG00000114503
Pharos: P52298(Tbio)
UniProt: P52298
Structure
LinkDB
Position
3:complement(196935406..196942528)
AA seq 156 aa
MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELF
SKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFK
EGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ
NT seq 471 nt   +upstreamnt  +downstreamnt
atgtcgggtggcctcctgaaggcgctgcgcagcgactcctacgtggagctgagccagtac
cgggaccagcacttccggggtgacaatgaagaacaagaaaaattactgaagaaaagctgt
acgttatatgttggaaatctttctttttacacaactgaagaacaaatctatgaactcttc
agcaaaagtggtgacataaagaaaatcattatgggtctggataaaatgaagaaaacagca
tgtggattctgttttgtggaatattactcacgcgcagatgcggaaaacgccatgcggtac
ataaatgggacgcgtctggatgaccgaatcattcgcacagactgggacgcaggctttaag
gagggcaggcaatacggccgtgggcgatctgggggccaggttcgggatgagtatcggcag
gactacgatgctgggagaggaggctatggaaaactggcacagaaccagtga

KEGG   Homo sapiens (human): 392517
Entry
392517            CDS       T01001                                 
Symbol
NCBP2L, dJ820B18.1
Name
(RefSeq) nuclear cap binding protein subunit 2 like
  KO
K12883  nuclear cap-binding protein subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
hsa03040  Spliceosome
Drug target
Obefazimod: D12345
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    392517 (NCBP2L)
  09122 Translation
   03013 Nucleocytoplasmic transport
    392517 (NCBP2L)
   03015 mRNA surveillance pathway
    392517 (NCBP2L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    392517 (NCBP2L)
   03041 Spliceosome [BR:hsa03041]
    392517 (NCBP2L)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Cap binding complex
     392517 (NCBP2L)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   Cap binding complex
    392517 (NCBP2L)
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 392517
NCBI-ProteinID: NP_001335301
HGNC: 31795
Ensembl: ENSG00000170935
UniProt: A6PVI3
LinkDB
Position
X:107777733..107795829
AA seq 153 aa
MSKDLKILCKDPALELSCYRDHQFSGRKFQQEKLLKESSTLNMGNLSFYTTEEKIHELFS
RSDIRNIFMGLDKIKKTACGFCFVECHNRADAENAMRFLTGTCLDEWIICTDWDVGFREG
QQYGRGKSGGQVRDEFREDFHSGRGGFGRQTQI
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtccaaagacctgaaaattctatgtaaagaccctgctttggagctgagctgctaccgg
gaccatcagttcagtggccgtaaatttcagcaggaaaaattactgaaggaaagctccaca
ttgaatatggggaatctttccttttatacaaccgaagagaaaatacatgaactctttagt
agatctgatatcaggaatatctttatgggcctggataaaataaagaaaacagcatgtggt
ttttgctttgtagaatgccataacagagctgatgctgaaaatgccatgcggtttctaact
gggacctgcctagatgaatggattatctgcactgattgggatgtcggttttagagagggt
caacagtatggtcgcggtaaatctgggggtcaggtaagggatgagtttcgtgaagatttt
cattctggtagaggaggctttggaagacagactcagatctag

KEGG   Homo sapiens (human): 4686
Entry
4686              CDS       T01001                                 
Symbol
NCBP1, CBP80, NCBP, Sto1
Name
(RefSeq) nuclear cap binding protein subunit 1
  KO
K12882  nuclear cap-binding protein subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa03015  mRNA surveillance pathway
hsa03040  Spliceosome
hsa05014  Amyotrophic lateral sclerosis
Network
nt06424  RNA processing
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Drug target
Obefazimod: D12345
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    4686 (NCBP1)
  09122 Translation
   03013 Nucleocytoplasmic transport
    4686 (NCBP1)
   03015 mRNA surveillance pathway
    4686 (NCBP1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    4686 (NCBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    4686 (NCBP1)
   03041 Spliceosome [BR:hsa03041]
    4686 (NCBP1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Cap binding complex
     4686 (NCBP1)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   Cap binding complex
    4686 (NCBP1)
SSDB
Motif
Pfam: MIF4G_like_2 MIF4G_like MIF4G Jnk-SapK_ap_N Tropomyosin_1
Other DBs
NCBI-GeneID: 4686
NCBI-ProteinID: NP_002477
OMIM: 600469
HGNC: 7658
Ensembl: ENSG00000136937
Pharos: Q09161(Tbio)
UniProt: Q09161 A0A024R179
Structure
LinkDB
Position
9:97633821..97673748
AA seq 790 aa
MSRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEAD
LPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANN
YNEAVYLVRFLSDLVNCHVIAAPSMVAMFENFVSVTQEEDVPQVRRDWYVYAFLSSLPWV
GKELYEKKDAEMDRIFANTESYLKRRQKTHVPMLQVWTADKPHPQEEYLDCLWAQIQKLK
KDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPHTEDSVYPMPRVIFRMFDYTDDPEG
PVMPGSHSVERFVIEENLHCIIKSHWKERKTCAAQLVSYPGKNKIPLNYHIVEVIFAELF
QLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHH
LSNFQFRWSWEDWSDCLSQDPESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSALCPAN
PTCIYKYGDESSNSLPGHSVALCLAVAFKSKATNDEIFSILKDVPNPNQDDDDDEGFSFN
PLKIEVFVQTLLHLAAKSFSHSFSALAKFHEVFKTLAESDEGKLHVLRVMFEVWRNHPQM
IAVLVDKMIRTQIVDCAAVANWIFSSELSRDFTRLFVWEILHSTIRKMNKHVLKIQKELE
EAKEKLARQHKRRSDDDDRSSDRKDGVLEEQIERLQEKVESAQSEQKNLFLVIFQRFIMI
LTEHLVRCETDGTSVLTPWYKNCIERLQQIFLQHHQIIQQYMVTLENLLFTAELDPHILA
VFQQFCALQA
NT seq 2373 nt   +upstreamnt  +downstreamnt
atgtcgcggcggcggcacagcgacgagaacgacggtgggcagcctcacaaaaggagaaag
acctctgatgcaaatgaaactgaagatcatttggaatctttaatatgtaaagtaggagaa
aagagtgcctgctctttggagagcaacctagaaggcttggctggtgttttggaagctgat
cttcctaactacaagagcaagatcttaaggcttctttgtacagttgcacgcctattacct
gagaagctgacaatttatacaacattagttggactactgaatgccaggaattacaatttt
ggtggagaatttgtagaagccatgattcgtcaacttaaagaatcattgaaagcaaacaat
tataatgaagccgtgtatttggtccgttttttatctgatcttgtgaattgtcatgtgatt
gccgccccatcaatggttgctatgtttgaaaattttgtaagcgtaactcaggaagaagat
gtacctcaggtgcgacgagattggtatgtgtatgcatttctgtcatctttgccctgggtt
ggaaaggagttgtacgaaaagaaagatgcagagatggaccgcatctttgccaacactgaa
agctatcttaaaagacgccaaaagactcatgtacccatgttacaggtatggactgctgat
aaaccacatccacaagaagagtatttagattgcctgtgggcccagattcagaaattgaaa
aaggatcgctggcaggaacggcacatcctaagaccttatcttgcctttgacagcatcctg
tgtgaagcactgcagcacaatctgcctccttttacaccacctcctcacactgaagattca
gtgtacccaatgccaagggtcatcttcagaatgtttgattacacagatgatcccgagggt
cctgtcatgccagggagtcattcagtggaaagatttgtaatagaagagaatcttcactgc
atcattaagtcccactggaaggaaaggaagacttgtgctgcacagttagtgagctatcca
gggaagaacaagatccccttgaactaccacatagttgaggtgatctttgcagagctgttt
caacttccagcaccccctcacattgatgtgatgtacacaacactcctcattgaactgtgc
aaacttcaacctggctctctaccccaagttcttgcacaggcaactgaaatgctatacatg
cgtttggacacaatgaacactacctgtgtagacaggtttattaattggttttctcatcat
ctaagtaacttccagttccgttggagctgggaagattggtcagattgtcttagtcaagat
cctgaaagtcccaaaccgaagtttgtaagagaagttctagaaaaatgtatgaggttgtct
taccatcagcgtatattagatattgttcctcctaccttctcagctctgtgtcctgcaaac
ccaacctgcatttacaagtatggagatgaaagtagcaattctcttcctggacattctgtt
gccctctgtttagctgttgcctttaaaagtaaggcaaccaatgatgaaatcttcagcatt
ctgaaagatgtaccaaatcctaaccaggatgatgacgacgatgaaggattcagttttaac
ccattgaaaatagaagtctttgtacagactctgctacacttggcagccaaatcattcagc
cactccttcagtgctcttgcaaagtttcatgaagtcttcaaaaccctagctgaaagtgat
gaaggaaagttacatgtgctaagagttatgtttgaggtctggaggaaccatccacagatg
attgctgtactagtggataagatgattcgtacacaaatagttgattgtgctgccgtagca
aattggatcttctcttcagaactatctcgtgactttaccagattgtttgtttgggaaatt
ttgcactctacaattcgtaagatgaacaaacatgtcctgaagatccagaaagagctggaa
gaagctaaagagaaacttgctaggcaacacaaacggcgaagtgatgatgacgacagaagc
agtgacaggaaagacggggttcttgaggaacaaatagaacgacttcaggaaaaagtggaa
tctgctcagagtgaacaaaagaatcttttcctcgttatatttcagcggtttatcatgatc
ttgaccgagcacctagtacgatgcgaaactgatgggaccagtgtattaacaccatggtat
aagaactgtatagagaggctgcagcagatcttcctacagcatcaccaaataatccagcag
tacatggtgaccctggagaaccttctcttcactgctgaattagaccctcatatcttggcc
gtgttccagcagttctgtgccctgcaggcctaa

DBGET integrated database retrieval system