KEGG   Homo sapiens (human): 23430
Entry
23430             CDS       T01001                                 
Symbol
TPSD1, MCP7-LIKE, MCP7L1, MMCP-7L
Name
(RefSeq) tryptase delta 1
  KO
K01340  tryptase [EC:3.4.21.59]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    23430 (TPSD1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    23430 (TPSD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.59  tryptase
     23430 (TPSD1)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   23430 (TPSD1)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 23430
NCBI-ProteinID: NP_036349
OMIM: 609272
HGNC: 14118
Ensembl: ENSG00000095917
Vega: OTTHUMG00000128511
Pharos: Q9BZJ3(Tbio)
UniProt: Q9BZJ3
LinkDB
Position
16:1256069..1259008
AA seq 242 aa
MLLLAPQMLSLLLLALPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGP
YWMHFCGGSLIHPQWVLTAAHCVEPDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQF
YIIQTGADIALLELEEPVNISSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNVHLPPPY
PLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDDMLCAGSENHDSCQGDSGGPLVCKVN
GT
NT seq 729 nt   +upstreamnt  +downstreamnt
atgctcctccttgctccccagatgctgagcctgctgctgctggcgctgcccgtcctggcg
agcccggcctacgtggcccctgccccaggccaggccctgcagcaaacgggcattgttggg
gggcaggaggcccccaggagcaagtggccctggcaggtgagcctgagagtccgcggccca
tactggatgcacttctgcgggggctccctcatccacccccagtgggtgctaaccgcggcg
cactgcgtggaaccggacatcaaggatctggccgccctcagggtgcaactgcgggagcag
cacctctactaccaggaccagctgctgccggtcagcaggatcatcgtgcacccacagttc
tacatcatccagaccggggcggacatcgccctgctggagctggaggagcccgtgaacatc
tccagccacatccacacggtcacgctgccccctgcctcggagaccttccccccggggatg
ccgtgctgggtcactggctggggcgacgtggacaataatgtgcacctgccgccgccatac
ccgctgaaggaggtggaagtccccgtagtggaaaaccacctttgcaacgcggaatatcac
accggcctccatacgggccacagctttcaaatcgtccgcgatgacatgctgtgtgcgggg
agcgaaaatcacgactcctgccagggtgactctggagggcccctggtctgcaaggtgaat
ggcacctaa

KEGG   Homo sapiens (human): 64499
Entry
64499             CDS       T01001                                 
Symbol
TPSB2, TPS2, tryptaseB, tryptaseC
Name
(RefSeq) tryptase beta 2
  KO
K01340  tryptase [EC:3.4.21.59]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    64499 (TPSB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    64499 (TPSB2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.59  tryptase
     64499 (TPSB2)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   64499 (TPSB2)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 64499
NCBI-ProteinID: NP_077078
OMIM: 191081
HGNC: 14120
Ensembl: ENSG00000197253
Vega: OTTHUMG00000155926
UniProt: P20231 A0A140VJT7
Structure
LinkDB
Position
16:complement(1228336..1230184)
AA seq 275 aa
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVRDRYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
NT seq 828 nt   +upstreamnt  +downstreamnt
atgctgaatctgctgctgctggcgctgcccgtcctggcgagccgcgcctacgcggcccct
gccccaggccaggccctgcagcgagtgggcatcgttgggggtcaggaggcccccaggagc
aagtggccctggcaggtgagcctgagagtccgcgaccgatactggatgcacttctgcggg
ggctccctcatccacccccagtgggtgctgaccgcagcgcactgcgtgggaccggacgtc
aaggatctggccgccctcagggtgcaactgcgggagcagcacctctactaccaggaccag
ctgctgccggtcagcaggatcatcgtgcacccacagttctacaccgcccagatcggagcg
gacatcgccctgctggagctggaggagccggtgaacgtctccagccacgtccacacggtc
accctgccccctgcctcagagaccttccccccggggatgccgtgctgggtcactggctgg
ggcgatgtggacaatgatgagcgcctcccaccgccatttcctctgaagcaggtgaaggtc
cccataatggaaaaccacatttgtgacgcaaaataccaccttggcgcctacacgggagac
gacgtccgcatcgtccgtgacgacatgctgtgtgccgggaacacccggagggactcatgc
cagggcgactccggagggcccctggtgtgcaaggtgaatggcacctggctgcaggcgggc
gtggtcagctggggcgagggctgtgcccagcccaaccggcctggcatctacacccgtgtc
acctactacttggactggatccaccactatgtccccaaaaagccgtga

KEGG   Homo sapiens (human): 7177
Entry
7177              CDS       T01001                                 
Symbol
TPSAB1, TPS1, TPS2, TPSB1, TPSB2, Tryptase-2
Name
(RefSeq) tryptase alpha/beta 1
  KO
K01340  tryptase [EC:3.4.21.59]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    7177 (TPSAB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    7177 (TPSAB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.59  tryptase
     7177 (TPSAB1)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   7177 (TPSAB1)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986 GO-like_E_set
Other DBs
NCBI-GeneID: 7177
NCBI-ProteinID: NP_003285
OMIM: 191080
HGNC: 12019
Ensembl: ENSG00000172236
Vega: OTTHUMG00000090467
Pharos: Q15661(Tclin) P20231(Tbio)
UniProt: Q15661 P20231
Structure
LinkDB
Position
16:1240705..1242554
AA seq 275 aa
MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCG
GSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGA
DIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKV
PIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAG
VVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP
NT seq 828 nt   +upstreamnt  +downstreamnt
atgctgaatctgctgctgctggcgctgcccgtcctggcgagccgcgcctacgcggcccct
gccccaggccaggccctgcagcgagtgggcatcgtcgggggtcaggaggcccccaggagc
aagtggccctggcaggtgagcctgagagtccacggcccatactggatgcacttctgcggg
ggctccctcatccacccccagtgggtgctgaccgcagcgcactgcgtgggaccggacgtc
aaggatctggccgccctcagggtgcaactgcgggagcagcacctctactaccaggaccag
ctgctgccggtcagcaggatcatcgtgcacccacagttctacaccgcccagatcggagcg
gacatcgccctgctggagctggaggagccggtgaacgtctccagccacgtccacacggtc
accctgccccctgcctcagagaccttccccccggggatgccgtgctgggtcactggctgg
ggcgatgtggacaatgatgagcgcctcccaccgccatttcctctgaagcaggtgaaggtc
cccataatggaaaaccacatttgtgacgcaaaataccaccttggcgcctacacgggagac
gacgtccgcatcgtccgtgacgacatgctgtgtgccgggaacacccggagggactcatgc
cagggcgactccggagggcccctggtgtgcaaggtgaatggcacctggctgcaggcgggc
gtggtcagctggggcgagggctgtgcccagcccaaccggcctggcatctacacccgtgtc
acctactacttggactggatccaccactatgtccccaaaaagccgtga

DBGET integrated database retrieval system