KEGG   Homo sapiens (human): 23590
Entry
23590             CDS       T01001                                 
Symbol
PDSS1, COQ1, COQ10D2, COQ1A, DPS, SPS, TPRT, TPT, TPT_1, hDPS1
Name
(RefSeq) decaprenyl diphosphate synthase subunit 1
  KO
K12504  decaprenyl-diphosphate synthase subunit 1 [EC:2.5.1.91]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00900  Terpenoid backbone biosynthesis
Disease
H00999  Coenzyme Q10 deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    23590 (PDSS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:hsa01006]
    23590 (PDSS1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.91  all-trans-decaprenyl-diphosphate synthase
     23590 (PDSS1)
Prenyltransferases [BR:hsa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   23590 (PDSS1)
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-GeneID: 23590
NCBI-ProteinID: NP_055132
OMIM: 607429
HGNC: 17759
Ensembl: ENSG00000148459
Vega: OTTHUMG00000017844
Pharos: Q5T2R2(Tbio)
UniProt: Q5T2R2
LinkDB
Position
10:26697701..26746798
AA seq 415 aa
MASRWWRWRRGCSWKPAARSPGPGSPGRAGPLGPSAAAEVRAQVHRRKGLDLSQIPYINL
VKHLTSACPNVCRISRFHHTTPDSKTHSGEKYTDPFKLGWRDLKGLYEDIRKELLISTSE
LKEMSEYYFDGKGKAFRPIIVALMARACNIHHNNSRHVQASQRAIALIAEMIHTASLVHD
DVIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISILTQVIEDLVR
GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHEIAYQYGKNVG
IAFQLIDDVLDFTSCSDQMGKPTSADLKLGLATGPVLFACQQFPEMNAMIMRRFSLPGDV
DRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLRPSPERDALIQLSEIVLTRDK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggcctcgcgctggtggcggtggcggcgcggctgctcctggaagccggcggcgcggagc
cccgggcccggctcccccggccgtgcgggaccgttggggccgagcgccgctgccgaagtc
cgcgcgcaggttcataggcggaagggacttgacttgtctcagataccctatattaatctt
gtgaagcatttaacatctgcctgtccaaatgtatgtcgtatatcacggtttcatcacaca
accccagacagtaaaacacacagtggtgaaaaatacaccgatcctttcaaactcggttgg
agagacttgaaaggtctgtatgaggacattagaaaggaactgcttatatcaacatcagaa
cttaaggaaatgtctgagtactactttgatgggaaagggaaagcctttcgaccaattatt
gtggcgctaatggcccgagcatgcaatattcatcataacaactcccgacatgtgcaagcc
agccagcgcgccatagccttaattgcagaaatgatccacactgctagtctggttcacgat
gacgttattgacgatgcaagttctcgaagaggaaaacacacagttaataagatctggggt
gaaaagaaggctgttcttgctggagatttaattctttctgcagcatctatagctctggca
cgaattggaaatacaactgttatatctattttaacccaagttattgaagatttggtgcgt
ggtgaatttcttcagctcgggtcaaaagaaaatgagaatgaaagatttgcacactacctt
gagaagacattcaagaagaccgccagcctgatagccaacagttgtaaagcagtctctgtt
ctaggatgtcccgacccagtggtgcatgagatcgcctatcagtacggaaaaaatgtagga
atagcttttcagctaatagatgatgtattggacttcacctcgtgttctgaccagatgggc
aaaccaacatcagctgatctgaagctcgggttagccactggtcctgtcctgtttgcctgt
cagcagttcccagaaatgaatgctatgatcatgcgacggttcagtttgcctggagatgta
gacagagctcgacagtatgtactacagagtgatggtgtgcaacaaacaacctacctcgcc
cagcagtactgccatgaagcaataagagagatcagtaaacttcgaccatccccagaaaga
gatgccctcattcagctttcagaaattgtactcacaagagataaatga

KEGG   Homo sapiens (human): 57107
Entry
57107             CDS       T01001                                 
Symbol
PDSS2, C6orf210, COQ10D3, COQ1B, DLP1, bA59I9.3, hDLP1
Name
(RefSeq) decaprenyl diphosphate synthase subunit 2
  KO
K12505  decaprenyl-diphosphate synthase subunit 2 [EC:2.5.1.91]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00900  Terpenoid backbone biosynthesis
Disease
H00999  Coenzyme Q10 deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    57107 (PDSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:hsa01006]
    57107 (PDSS2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.91  all-trans-decaprenyl-diphosphate synthase
     57107 (PDSS2)
Prenyltransferases [BR:hsa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   57107 (PDSS2)
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-GeneID: 57107
NCBI-ProteinID: NP_065114
OMIM: 610564
HGNC: 23041
Ensembl: ENSG00000164494
Vega: OTTHUMG00000059359
Pharos: Q86YH6(Tbio)
UniProt: Q86YH6
LinkDB
Position
6:complement(107152562..107459564)
AA seq 399 aa
MNFRQLLLHLPRYLGASGSPRRLWWSPSLDTISSVGSWRGRSSKSPAHWNQVVSEAEKIV
GYPTSFMSLRCLLSDELSNIAMQVRKLVGTQHPLLTTARGLVHDSWNSLQLRGLVVLLIS
KAAGPSSVNTSCQNYDMVSGIYSCQRSLAEITELIHIALLVHRGIVNLNELQSSDGPLKD
MQFGNKIAILSGDFLLANACNGLALLQNTKVVELLASALMDLVQGVYHENSTSKESYITD
DIGISTWKEQTFLSHGALLAKSCQAAMELAKHDAEVQNMAFQYGKHMAMSHKINSDVQPF
IKEKTSDSMTFNLNSAPVVLHQEFLGRDLWIKQIGEAQEKGRLDYAKLRERIKAGKGVTS
AIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgaactttcggcagctgctgttgcacttgccacgttatcttggagcctcgggttccccg
cgtcgcctgtggtggtccccgtccctcgacaccatctcctcggtgggctcttggcgtggt
cggtcctccaagtccccggcccactggaatcaggtagtgtcagaggcggagaagatcgtg
gggtaccccacgtccttcatgagccttcgctgcctgctgagcgacgagctcagcaacatc
gctatgcaggtgcggaagctggtgggcactcagcaccctctgcttaccacagccaggggg
cttgtacatgacagctggaatagcctccagttgaggggcttggtggtgctccttatctct
aaagcagctgggcccagcagcgtgaacacttcatgtcagaactatgacatggtcagtggg
atctactcatgtcaaagaagtttggcagagatcacggagctaattcatattgctctcctt
gtacatcgtgggatagtaaatttaaatgagttgcaatcatctgatggtccactgaaagac
atgcaatttggaaataaaattgctatcctgagtggagactttcttctagcaaatgcctgc
aatggactagctctgctacagaacaccaaggttgtggaacttttagcaagtgctcttatg
gacttggtacaaggagtatatcatgaaaattctacttcaaaggaaagttatatcacagat
gatattggaatatcgacttggaaggagcagacttttctctcccatggtgccttactagca
aagagctgccaagctgcaatggaattagcaaagcatgatgctgaggttcagaatatggca
tttcagtatgggaagcacatggccatgagtcataagataaattctgatgtccagcctttt
attaaagaaaagaccagtgactccatgacttttaatctaaactcagctcctgtagtctta
catcaggaatttcttggaagagatttgtggattaaacagatcggagaggctcaagaaaaa
ggaagattggactatgctaagttgcgagaaagaatcaaagctggcaaaggtgtgacttca
gctattgacctgtgtcgttaccatggaaacaaggcactggaggccctggagagctttcct
ccctcggaggccagatctgctttagaaaacattgtgtttgctgtgaccagattttcatga

DBGET integrated database retrieval system