KEGG   Homo sapiens (human): 23621
Entry
23621             CDS       T01001                                 
Symbol
BACE1, ASP2, BACE, HSPC104
Name
(RefSeq) beta-secretase 1
  KO
K04521  beta-site APP-cleaving enzyme 1 (memapsin 2) [EC:3.4.23.46]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
Drug target
Atabecestat: D11456
Elenbecestat: D11509
Lanabecestat (DG02834): D10946 D10947
Umibecestat: D11690
Verubecestat: D10739
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    23621 (BACE1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    23621 (BACE1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.46  memapsin 2
     23621 (BACE1)
Peptidases and inhibitors [BR:hsa01002]
 Aspartic peptidases
  Family A1: pepsin family
   23621 (BACE1)
SSDB
Motif
Pfam: Asp TAXi_C TAXi_N
Other DBs
NCBI-GeneID: 23621
NCBI-ProteinID: NP_036236
OMIM: 604252
HGNC: 933
Ensembl: ENSG00000186318
Vega: OTTHUMG00000160636
Pharos: P56817(Tchem)
UniProt: P56817 A0A024R3D7
Structure
LinkDB
Position
11:complement(117285698..117316256)
AA seq 501 aa
MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSF
VEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSST
YRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGIL
GLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGI
DHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK
VFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRIT
ILPQQYLRPVEDVATSQDDCYKFAISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSAC
HVHDEFRTAAVEGPFVTLDMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQW
RCLRCLRQQHDDFADDISLLK
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggcccaagccctgccctggctcctgctgtggatgggcgcgggagtgctgcctgcccac
ggcacccagcacggcatccggctgcccctgcgcagcggcctggggggcgcccccctgggg
ctgcggctgccccgggagaccgacgaagagcccgaggagcccggccggaggggcagcttt
gtggagatggtggacaacctgaggggcaagtcggggcagggctactacgtggagatgacc
gtgggcagccccccgcagacgctcaacatcctggtggatacaggcagcagtaactttgca
gtgggtgctgccccccaccccttcctgcatcgctactaccagaggcagctgtccagcaca
taccgggacctccggaagggtgtgtatgtgccctacacccagggcaagtgggaaggggag
ctgggcaccgacctggtaagcatcccccatggccccaacgtcactgtgcgtgccaacatt
gctgccatcactgaatcagacaagttcttcatcaacggctccaactgggaaggcatcctg
gggctggcctatgctgagattgccaggcctgacgactccctggagcctttctttgactct
ctggtaaagcagacccacgttcccaacctcttctccctgcagctttgtggtgctggcttc
cccctcaaccagtctgaagtgctggcctctgtcggagggagcatgatcattggaggtatc
gaccactcgctgtacacaggcagtctctggtatacacccatccggcgggagtggtattat
gaggtgatcattgtgcgggtggagatcaatggacaggatctgaaaatggactgcaaggag
tacaactatgacaagagcattgtggacagtggcaccaccaaccttcgtttgcccaagaaa
gtgtttgaagctgcagtcaaatccatcaaggcagcctcctccacggagaagttccctgat
ggtttctggctaggagagcagctggtgtgctggcaagcaggcaccaccccttggaacatt
ttcccagtcatctcactctacctaatgggtgaggttaccaaccagtccttccgcatcacc
atccttccgcagcaatacctgcggccagtggaagatgtggccacgtcccaagacgactgt
tacaagtttgccatctcacagtcatccacgggcactgttatgggagctgttatcatggag
ggcttctacgttgtctttgatcgggcccgaaaacgaattggctttgctgtcagcgcttgc
catgtgcacgatgagttcaggacggcagcggtggaaggcccttttgtcaccttggacatg
gaagactgtggctacaacattccacagacagatgagtcaaccctcatgaccatagcctat
gtcatggctgccatctgcgccctcttcatgctgccactctgcctcatggtgtgtcagtgg
cgctgcctccgctgcctgcgccagcagcatgatgactttgctgatgacatctccctgctg
aagtga

KEGG   Homo sapiens (human): 25825
Entry
25825             CDS       T01001                                 
Symbol
BACE2, AEPLC, ALP56, ASP1, ASP21, BAE2, CDA13, CEAP1, DRAP
Name
(RefSeq) beta-secretase 2
  KO
K07747  beta-site APP-cleaving enzyme 2 (memapsin 1) [EC:3.4.23.45]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
Drug target
Elenbecestat: D11509
Verubecestat: D10739
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    25825 (BACE2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    25825 (BACE2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.45  memapsin 1
     25825 (BACE2)
Peptidases and inhibitors [BR:hsa01002]
 Aspartic peptidases
  Family A1: pepsin family
   25825 (BACE2)
SSDB
Motif
Pfam: Asp TAXi_C TAXi_N
Other DBs
NCBI-GeneID: 25825
NCBI-ProteinID: NP_036237
OMIM: 605668
HGNC: 934
Ensembl: ENSG00000182240
Vega: OTTHUMG00000086742
Pharos: Q9Y5Z0(Tchem)
UniProt: Q9Y5Z0
Structure
LinkDB
Position
21:41168160..41282530
AA seq 518 aa
MGALARALLLPLLAQWLLRAAPELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGL
ALALEPALASPAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG
TPHSYIDTYFDTERSSTYRSKGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATI
FESENFFLPGIKWNGILGLAYATLAKPSSSLETFFDSLVTQANIPNVFSMQMCGAGLPVA
GSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILKLEIGGQSLNLDCREYNADKA
IVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISI
YLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFD
RAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVPAQSLSEPILWIVSYALMSVCG
AILLVLIVLLLLPFRCQRRPRDPEVVNDESSLVRHRWK
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgggcgcactggcccgggcgctgctgctgcctctgctggcccagtggctcctgcgcgcc
gccccggagctggcccccgcgcccttcacgctgcccctccgggtggccgcggccacgaac
cgcgtagttgcgcccaccccgggacccgggacccctgccgagcgccacgccgacggcttg
gcgctcgccctggagcctgccctggcgtcccccgcgggcgccgccaacttcttggccatg
gtagacaacctgcagggggactctggccgcggctactacctggagatgctgatcgggacc
cccccgcagaagctacagattctcgttgacactggaagcagtaactttgccgtggcagga
accccgcactcctacatagacacgtactttgacacagagaggtctagcacataccgctcc
aagggctttgacgtcacagtgaagtacacacaaggaagctggacgggcttcgttggggaa
gacctcgtcaccatccccaaaggcttcaatacttcttttcttgtcaacattgccactatt
tttgaatcagagaatttctttttgcctgggattaaatggaatggaatacttggcctagct
tatgccacacttgccaagccatcaagttctctggagaccttcttcgactccctggtgaca
caagcaaacatccccaacgttttctccatgcagatgtgtggagccggcttgcccgttgct
ggatctgggaccaacggaggtagtcttgtcttgggtggaattgaaccaagtttgtataaa
ggagacatctggtatacccctattaaggaagagtggtactaccagatagaaattctgaaa
ttggaaattggaggccaaagccttaatctggactgcagagagtataacgcagacaaggcc
atcgtggacagtggcaccacgctgctgcgcctgccccagaaggtgtttgatgcggtggtg
gaagctgtggcccgcgcatctctgattccagaattctctgatggtttctggactgggtcc
cagctggcgtgctggacgaattcggaaacaccttggtcttacttccctaaaatctccatc
tacctgagagacgagaactccagcaggtcattccgtatcacaatcctgcctcagctttac
attcagcccatgatgggggccggcctgaattatgaatgttaccgattcggcatttcccca
tccacaaatgcgctggtgatcggtgccacggtgatggagggcttctacgtcatcttcgac
agagcccagaagagggtgggcttcgcagcgagcccctgtgcagaaattgcaggtgctgca
gtgtctgaaatttccgggcctttctcaacagaggatgtagccagcaactgtgtccccgct
cagtctttgagcgagcccattttgtggattgtgtcctatgcgctcatgagcgtctgtgga
gccatcctccttgtcttaatcgtcctgctgctgctgccgttccggtgtcagcgtcgcccc
cgtgaccctgaggtcgtcaatgatgagtcctctctggtcagacatcgctggaaatga

DBGET integrated database retrieval system