KEGG   Homo sapiens (human): 2487
Entry
2487              CDS       T01001                                 
Symbol
FRZB, FRE, FRITZ, FRP-3, FRZB-1, FRZB-PEN, FRZB1, FZRB, OS1, SFRP3, SRFP3, hFIZ
Name
(RefSeq) frizzled related protein
  KO
K25481  secreted frizzled-related protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    2487 (FRZB)
SSDB
Motif
Pfam: Fz NTR
Other DBs
NCBI-GeneID: 2487
NCBI-ProteinID: NP_001454
OMIM: 605083
HGNC: 3959
Ensembl: ENSG00000162998
Pharos: Q92765(Tbio)
UniProt: Q92765 D9ZGF6
LinkDB
Position
2:complement(182833275..182866637)
AA seq 325 aa
MVCGSPGGMLLLRAGLLALAALCLLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHS
TQANAILAIEQFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCE
PILIKYRHSWPENLACEELPVYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKC
KPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTS
SGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSK
SDSSNSDSTQSQKSGRNSNPRQARN
NT seq 978 nt   +upstreamnt  +downstreamnt
atggtctgcggcagcccgggagggatgctgctgctgcgggccgggctgcttgccctggct
gctctctgcctgctccgggtgcccggggctcgggctgcagcctgtgagcccgtccgcatc
cccctgtgcaagtccctgccctggaacatgactaagatgcccaaccacctgcaccacagc
actcaggccaacgccatcctggccatcgagcagttcgaaggtctgctgggcacccactgc
agccccgatctgctcttcttcctctgtgccatgtacgcgcccatctgcaccattgacttc
cagcacgagcccatcaagccctgtaagtctgtgtgcgagcgggcccggcagggctgtgag
cccatactcatcaagtaccgccactcgtggccggagaacctggcctgcgaggagctgcca
gtgtacgacaggggcgtgtgcatctctcccgaggccatcgttactgcggacggagctgat
tttcctatggattctagtaacggaaactgtagaggggcaagcagtgaacgctgtaaatgt
aagcctattagagctacacagaagacctatttccggaacaattacaactatgtcattcgg
gctaaagttaaagagataaagactaagtgccatgatgtgactgcagtagtggaggtgaag
gagattctaaagtcctctctggtaaacattccacgggacactgtcaacctctataccagc
tctggctgcctctgccctccacttaatgttaatgaggaatatatcatcatgggctatgaa
gatgaggaacgttccagattactcttggtggaaggctctatagctgagaagtggaaggat
cgactcggtaaaaaagttaagcgctgggatatgaagcttcgtcatcttggactcagtaaa
agtgattctagcaatagtgattccactcagagtcagaagtctggcaggaactcgaacccc
cggcaagcacgcaactaa

KEGG   Homo sapiens (human): 6422
Entry
6422              CDS       T01001                                 
Symbol
SFRP1, FRP, FRP-1, FRP1, FrzA, SARP2
Name
(RefSeq) secreted frizzled related protein 1
  KO
K02166  secreted frizzled-related protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6422 (SFRP1)
SSDB
Motif
Pfam: Fz NTR DUF555
Other DBs
NCBI-GeneID: 6422
NCBI-ProteinID: NP_003003
OMIM: 604156
HGNC: 10776
Ensembl: ENSG00000104332
Pharos: Q8N474(Tchem)
UniProt: Q8N474
LinkDB
Position
8:complement(41261962..41309473)
AA seq 314 aa
MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVD
IPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPV
CLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKP
QGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKK
KDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKK
MKNHECPTFQSVFK
NT seq 945 nt   +upstreamnt  +downstreamnt
atgggcatcgggcgcagcgaggggggccgccgcggggcagccctgggcgtgctgctggcg
ctgggcgcggcgcttctggccgtgggctcggccagcgagtacgactacgtgagcttccag
tcggacatcggcccgtaccagagcgggcgcttctacaccaagccacctcagtgcgtggac
atccccgcggacctgcggctgtgccacaacgtgggctacaagaagatggtgctgcccaac
ctgctggagcacgagaccatggcggaggtgaagcagcaggccagcagctgggtgcccctg
ctcaacaagaactgccacgccggcacccaggtcttcctctgctcgctcttcgcgcccgtc
tgcctggaccggcccatctacccgtgtcgctggctctgcgaggccgtgcgcgactcgtgc
gagccggtcatgcagttcttcggcttctactggcccgagatgcttaagtgtgacaagttc
cccgagggggacgtctgcatcgccatgacgccgcccaatgccaccgaagcctccaagccc
caaggcacaacggtgtgtcctccctgtgacaacgagttgaaatctgaggccatcattgaa
catctctgtgccagcgagtttgcactgaggatgaaaataaaagaagtgaaaaaagaaaat
ggcgacaagaagattgtccccaagaagaagaagcccctgaagttggggcccatcaagaag
aaggacctgaagaagcttgtgctgtacctgaagaatggggctgactgtccctgccaccag
ctggacaacctcagccaccacttcctcatcatgggccgcaaggtgaagagccagtacttg
ctgacggccatccacaagtgggacaagaaaaacaaggagttcaaaaacttcatgaagaaa
atgaaaaaccatgagtgccccacctttcagtccgtgtttaagtga

KEGG   Homo sapiens (human): 6423
Entry
6423              CDS       T01001                                 
Symbol
SFRP2, FRP-2, SARP1, SDF-5
Name
(RefSeq) secreted frizzled related protein 2
  KO
K02176  secreted frizzled-related protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6423 (SFRP2)
SSDB
Motif
Pfam: Fz NTR
Other DBs
NCBI-GeneID: 6423
NCBI-ProteinID: NP_003004
OMIM: 604157
HGNC: 10777
Ensembl: ENSG00000145423
Pharos: Q96HF1(Tbio)
UniProt: Q96HF1 A0A140VJU3 B3KSM5
LinkDB
Position
4:complement(153780591..153789083)
AA seq 295 aa
MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRL
PNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQ
VKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKND
DDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLK
DSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC
NT seq 888 nt   +upstreamnt  +downstreamnt
atgctgcagggccctggctcgctgctgctgctcttcctcgcctcgcactgctgcctgggc
tcggcgcgcgggctcttcctctttggccagcccgacttctcctacaagcgcagcaattgc
aagcccatccctgccaacctgcagctgtgccacggcatcgaataccagaacatgcggctg
cccaacctgctgggccacgagaccatgaaggaggtgctggagcaggccggcgcttggatc
ccgctggtcatgaagcagtgccacccggacaccaagaagttcctgtgctcgctcttcgcc
cccgtctgcctcgatgacctagacgagaccatccagccatgccactcgctctgcgtgcag
gtgaaggaccgctgcgccccggtcatgtccgccttcggcttcccctggcccgacatgctt
gagtgcgaccgtttcccccaggacaacgacctttgcatccccctcgctagcagcgaccac
ctcctgccagccaccgaggaagctccaaaggtatgtgaagcctgcaaaaataaaaatgat
gatgacaacgacataatggaaacgctttgtaaaaatgattttgcactgaaaataaaagtg
aaggagataacctacatcaaccgagataccaaaatcatcctggagaccaagagcaagacc
atttacaagctgaacggtgtgtccgaaagggacctgaagaaatcggtgctgtggctcaaa
gacagcttgcagtgcacctgtgaggagatgaacgacatcaacgcgccctatctggtcatg
ggacagaaacagggtggggagctggtgatcacctcggtgaagcggtggcagaaggggcag
agagagttcaagcgcatctcccgcagcatccgcaagctgcagtgctag

KEGG   Homo sapiens (human): 6424
Entry
6424              CDS       T01001                                 
Symbol
SFRP4, FRP-4, FRPHE, FRZB-2, PYL, sFRP-4
Name
(RefSeq) secreted frizzled related protein 4
  KO
K02185  secreted frizzled-related protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Disease
H00479  Metaphyseal dysplasias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6424 (SFRP4)
SSDB
Motif
Pfam: Fz NTR
Other DBs
NCBI-GeneID: 6424
NCBI-ProteinID: NP_003005
OMIM: 606570
HGNC: 10778
Ensembl: ENSG00000106483
Pharos: Q6FHJ7(Tbio)
UniProt: Q6FHJ7
LinkDB
Position
7:complement(37905932..37916817)
AA seq 346 aa
MFLSILVALCLWLHLALGVRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQ
YEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWP
ESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKC
KKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITN
SSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQD
KKKTAGRTSRSNPPKPKGKPPAPKPASPKKNIKTRSAQKRTNPKRV
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgttcctctccatcctagtggcgctgtgcctgtggctgcacctggcgctgggcgtgcgc
ggcgcgccctgcgaggcggtgcgcatccctatgtgccggcacatgccctggaacatcacg
cggatgcccaaccacctgcaccacagcacgcaggagaacgccatcctggccatcgagcag
tacgaggagctggtggacgtgaactgcagcgccgtgctgcgcttcttcctctgtgccatg
tacgcgcccatttgcaccctggagttcctgcacgaccctatcaagccgtgcaagtcggtg
tgccaacgcgcgcgcgacgactgcgagcccctcatgaagatgtacaaccacagctggccc
gaaagcctggcctgcgacgagctgcctgtctatgaccgtggcgtgtgcatctcgcctgaa
gccatcgtcacggacctcccggaggatgttaagtggatagacatcacaccagacatgatg
gtacaggaaaggcctcttgatgttgactgtaaacgcctaagccccgatcggtgcaagtgt
aaaaaggtgaagccaactttggcaacgtatctcagcaaaaactacagctatgttattcat
gccaaaataaaagctgtgcagaggagtggctgcaatgaggtcacaacggtggtggatgta
aaagagatcttcaagtcctcatcacccatccctcgaactcaagtcccgctcattacaaat
tcttcttgccagtgtccacacatcctgccccatcaagatgttctcatcatgtgttacgag
tggcgctcaaggatgatgcttcttgaaaattgcttagttgaaaaatggagagatcagctt
agtaaaagatccatacagtgggaagagaggctgcaggaacagcggagaacagttcaggac
aagaagaaaacagccgggcgcaccagtcgtagtaatccccccaaaccaaagggaaagcct
cctgctcccaaaccagccagtcccaagaagaacattaaaactaggagtgcccagaagaga
acaaacccgaaaagagtgtga

KEGG   Homo sapiens (human): 6425
Entry
6425              CDS       T01001                                 
Symbol
SFRP5, SARP3
Name
(RefSeq) secreted frizzled related protein 5
  KO
K02222  secreted frizzled-related protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    6425 (SFRP5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    6425 (SFRP5)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I93
   6425 (SFRP5)
SSDB
Motif
Pfam: Fz NTR
Other DBs
NCBI-GeneID: 6425
NCBI-ProteinID: NP_003006
OMIM: 604158
HGNC: 10779
Ensembl: ENSG00000120057
Pharos: Q5T4F7(Tbio)
UniProt: Q5T4F7
LinkDB
Position
10:complement(97766751..97771999)
AA seq 317 aa
MRAAAAGGGVRTAALALLLGALHWAPARCEEYDYYGWQAEPLHGRSYSKPPQCLDIPADL
PLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRP
IYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKI
CAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDT
KRLVLHMKNGAGCPCPQLDSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFS
YPCSLYYPFFYGAAEPH
NT seq 954 nt   +upstreamnt  +downstreamnt
atgcgggcggcggcggcgggggggggcgtgcggacggccgcgctggcgctgctgctgggg
gcgctgcactgggcgccggcgcgctgcgaggagtacgactactatggctggcaggccgag
ccgctgcacggccgctcctactccaagccgccgcagtgccttgacatccctgccgacctg
ccgctctgccacacggtgggctacaagcgcatgcggctgcccaacctgctggagcacgag
agcctggccgaagtgaagcagcaggcgagcagctggctgccgctgctggccaagcgctgc
cactcggatacgcaggtcttcctgtgctcgctctttgcgcccgtctgtctcgaccggccc
atctacccgtgccgctcgctgtgcgaggccgtgcgcgccggctgcgcgccgctcatggag
gcctacggcttcccctggcctgagatgctgcactgccacaagttccccctggacaacgac
ctctgcatcgccgtgcagttcgggcacctgcccgccaccgcgcctccagtgaccaagatc
tgcgcccagtgtgagatggagcacagtgctgacggcctcatggagcagatgtgctccagt
gactttgtggtcaaaatgcgcatcaaggagatcaagatagagaatggggaccggaagctg
attggagcccagaaaaagaagaagctgctcaagccgggccccctgaagcgcaaggacacc
aagcggctggtgctgcacatgaagaatggcgcgggctgcccctgcccacagctggacagc
ctggcgggcagcttcctggtcatgggccgcaaagtggatggacagctgctgctcatggcc
gtctaccgctgggacaagaagaataaggagatgaagtttgcagtcaaattcatgttctcc
tacccctgctccctctactaccctttcttctacggggcggcagagccccactga

DBGET integrated database retrieval system