KEGG   Homo sapiens (human): 254122
Entry
254122            CDS       T01001                                 
Symbol
SNX32, SNX6B
Name
(RefSeq) sorting nexin 32
  KO
K17920  sorting nexin-5/6/32
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    254122 (SNX32)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    254122 (SNX32)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    254122 (SNX32)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Sorting nexins
    254122 (SNX32)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   254122 (SNX32)
SSDB
Motif
Pfam: Vps5 PX Latarcin
Other DBs
NCBI-GeneID: 254122
NCBI-ProteinID: NP_689973
HGNC: 26423
Ensembl: ENSG00000172803
Pharos: Q86XE0(Tdark)
UniProt: Q86XE0
Structure
LinkDB
Position
11:65833963..65853701
AA seq 403 aa
METYAEVGKEGKPSCASVDLQGDSSLQVEISDAVSERDKVKFTVQTKSCLPHFAQTEFSV
VRQHEEFIWLHDAYVENEEYAGLIIPPAPPRPDFEASREKLQKLGEGDSSVTREEFAKMK
QELEAEYLAIFKKTVAMHEVFLQRLAAHPTLRRDHNFFVFLEYGQDLSVRGKNRKELLGG
FLRNIVKSADEALITGMSGLKEVDDFFEHERTFLLEYHTRIRDACLRADRVMRAHKCLAD
DYIPISAALSSLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDS
QAAKDLLYRRLRALADYENANKALDKARTRNREVRPAESHQQLCCQRFERLSDSAKQELM
DFKSRRVSSFRKNLIELAELELKHAKASTLILRNTLVALKGEP
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggagacgtatgcggaggttgggaaggagggcaagccttcctgtgcatcggtggatctg
cagggagacagctccttacaggtggagatttctgacgcagtgagtgagcgggacaaggtg
aaattcactgttcaaacaaagagctgcctccctcacttcgcccagaccgagttctcagtc
gtgcggcagcacgaggagttcatctggctgcatgatgcctacgtggagaatgaggagtac
gccggcctcatcatccccccagcccctccgaggccagactttgaggcttcgagggaaaag
ctacagaaattgggcgagggggacagctctgtcactcgggaagagtttgccaagatgaag
caggagctggaagcggagtacctggccatctttaagaagacagttgcgatgcacgaagtc
tttctgcagcgcctggcggcccaccccaccctgcgtcgagaccacaacttctttgtgttt
ttggaatatggacaggatctgagtgtccgggggaagaacaggaaggagctcctcggaggg
tttctgaggaatattgtgaagtccgcggatgaagccctcatcacgggcatgtcagggctc
aaggaggtggatgacttctttgagcatgagaggaccttcctgttggagtatcacacccgt
atccgagatgcctgcctgcgggccgaccgcgtcatgcgcgcccacaagtgcctggcagac
gattatatccctatctcagctgcgctgagcagtctgggaacacaggaagtcaaccagcta
aggacgagcttcctcaaattggcagagctctttgaacggctgaggaagctggagggccgg
gtggcttccgatgaggacctgaagctgtcagacatgctgaggtactacatgcgtgactca
caggcagccaaggacctgctgtaccggcggctgcgggcactggccgactacgagaatgcc
aacaaggcgctggacaaggcgcgcaccaggaaccgggaggtgcggcccgccgagagccac
cagcagctgtgctgccaacgcttcgagcgcctctccgactccgccaagcaagagctcatg
gacttcaagtcccgccgggtctcctcttttcgaaagaatctcattgagctggcagagctg
gagctcaaacacgccaaggccagcaccctgattctccggaacacccttgttgccctaaag
ggggagccttag

KEGG   Homo sapiens (human): 27131
Entry
27131             CDS       T01001                                 
Symbol
SNX5
Name
(RefSeq) sorting nexin 5
  KO
K17920  sorting nexin-5/6/32
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    27131 (SNX5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27131 (SNX5)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    27131 (SNX5)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Sorting nexins
    27131 (SNX5)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   27131 (SNX5)
SSDB
Motif
Pfam: Vps5 PX BAR
Other DBs
NCBI-GeneID: 27131
NCBI-ProteinID: NP_055241
OMIM: 605937
HGNC: 14969
Ensembl: ENSG00000089006
Pharos: Q9Y5X3(Tbio)
UniProt: Q9Y5X3
Structure
LinkDB
Position
20:complement(17941600..17968794)
AA seq 404 aa
MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQS
PEFSVTRQHEDFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEE
FAKMKQELEAEYLAVFKKTVSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTK
EMFGGFFKSVVKSADEVLFTGVKEVDDFFEQEKNFLINYYNRIKDSCVKADKMTRSHKNV
ADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRVSSDEDLKLTELLRYYML
NIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKFEQLSESAKEE
LINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN
NT seq 1215 nt   +upstreamnt  +downstreamnt
atggccgcggttcccgagttgctgcagcagcaggaggaggaccgcagcaagctgagatct
gtatctgtggacctgaatgttgatccctcgcttcagattgacatacctgatgcgctcagt
gagagagacaaagtcaaatttacagtgcacacaaagaccacactgcccacgtttcagagc
ccagagttttctgttacaaggcaacatgaagactttgtgtggctacatgacactcttatt
gaaacaacagactatgctgggcttattattccacctgctcctacgaagcccgactttgat
ggtcctcgagagaagatgcagaaactgggagaaggtgaagggtctatgaccaaagaagaa
tttgccaagatgaaacaagaactggaagctgagtatctcgctgtgtttaagaagactgtg
tcctcccatgaagtctttcttcagcggctttcttctcaccctgttctcagtaaagatcgc
aactttcatgttttcctggaatatgatcaggatctaagtgttaggcggaaaaatactaaa
gagatgtttggtggcttcttcaaaagtgtggtgaaaagtgctgatgaagtcctttttact
ggagttaaggaggtagatgacttctttgagcaagagaagaacttccttattaactattac
aataggatcaaagattcttgtgtgaaagctgacaaaatgaccagatctcataaaaatgtt
gccgatgactatatccacaccgcagcctgcttacatagcctggctttagaagagcccaca
gtcatcaaaaagtacctattgaaggttgctgagctatttgaaaaactaaggaaagtagag
ggtcgagtttcatcagatgaagatttgaagctaacagagctcctccgatactacatgctc
aacattgaagctgctaaggatctcttatacagacgcaccaaagccctcattgactatgag
aactcaaacaaagctctggataaggcccggttaaagagcaaagacgtcaagttggctgag
gcacaccagcaggagtgctgccagaaatttgaacaactttccgaatctgcaaaagaagaa
ctgataaatttcaaacggaagagagtggcagcatttagaaagaatctaattgaaatgtct
gaactggaaataaaacatgccaggaacaatgtctcccttttgcagagctgtattgacttg
ttcaagaataactga

KEGG   Homo sapiens (human): 58533
Entry
58533             CDS       T01001                                 
Symbol
SNX6, MSTP010, TFAF2
Name
(RefSeq) sorting nexin 6
  KO
K17920  sorting nexin-5/6/32
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    58533 (SNX6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    58533 (SNX6)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    58533 (SNX6)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Sorting nexins
    58533 (SNX6)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   58533 (SNX6)
SSDB
Motif
Pfam: PX Vps5 BAR
Other DBs
NCBI-GeneID: 58533
NCBI-ProteinID: NP_689419
OMIM: 606098
HGNC: 14970
Ensembl: ENSG00000129515
Pharos: Q9UNH7(Tbio)
UniProt: Q9UNH7 A0A0A0MRI2
LinkDB
Position
14:complement(34561093..34630148)
AA seq 406 aa
MMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSERDKVKFTVHTKSSLPNFK
QNEFSVVRQHEEFIWLHDSFVENEDYAGYIIPPAPPRPDFDASREKLQKLGEGEGSMTKE
EFTKMKQELEAEYLAIFKKTVAMHEVFLCRVAAHPILRRDLNFHVFLEYNQDLSVRGKNK
KEKLEDFFKNMVKSADGVIVSGVKDVDDFFEHERTFLLEYHNRVKDASAKSDRMTRSHKS
AADDYNRIGSSLYALGTQDSTDICKFFLKVSELFDKTRKIEARVSADEDLKLSDLLKYYL
RESQAAKDLLYRRSRSLVDYENANKALDKARAKNKDVLQAETSQQLCCQKFEKISESAKQ
ELIDFKTRRVAAFRKNLVELAELELKHAKGNLQLLQNCLAVLNGDT
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgatggaaggcctggacgacggcccggacttcctctcagaagaggaccgcggacttaaa
gcaataaatgtagatcttcaaagtgatgctgctctgcaggtggacatttctgatgctctt
agtgagcgggataaagtaaaattcactgttcacacaaagagttcattgccaaattttaaa
caaaacgagttttcagttgttcggcaacatgaggaatttatctggcttcatgattccttt
gttgaaaatgaagactatgcaggttatatcattccaccagcaccaccaagacctgatttt
gatgcttcaagggaaaaactacagaagcttggtgaaggagaagggtcaatgacgaaggaa
gaattcacaaagatgaaacaggaactggaagctgaatatttggcaatattcaagaagaca
gttgcgatgcatgaagtgttcctgtgtcgtgtggcagcacatcctattttgagaagagat
ttaaatttccatgtcttcttggaatataatcaagatttgagtgtgcgaggaaaaaataaa
aaagagaaacttgaagacttctttaaaaacatggttaaatcagcagatggagtaatcgtt
tcaggagtaaaggatgtagatgatttctttgagcacgaacgaacatttcttttggagtat
cataaccgagttaaggatgcatctgctaaatctgatagaatgacaagatcccacaaaagt
gctgcagatgattacaatagaattggttcttcattatatgctttaggaactcaggattct
acagatatatgcaagttttttctcaaagtttcagaactgttcgataaaacaagaaaaata
gaagcacgagtgtctgctgatgaagacctcaaactttctgatcttttaaaatattactta
agagaatctcaagctgctaaggatctcctgtatcgaaggtctaggtcactagtggattat
gaaaatgctaataaagcactggataaagcaagagcaaaaaataaagatgttctacaggcc
gaaacttcccaacaattatgttgtcagaaatttgaaaaaatatctgagtctgcaaaacaa
gaacttatagattttaagacaagaagagttgctgcattcagaaaaaatttagtggaactg
gcagagttagaactgaagcatgcaaagggtaatctacagttgctgcagaactgcctggca
gtgttaaatggagacacataa

DBGET integrated database retrieval system