KEGG   Homo sapiens (human): 25788
Entry
25788             CDS       T01001                                 
Symbol
RAD54B, RDH54
Name
(RefSeq) RAD54 homolog B
  KO
K10877  DNA repair and recombination protein RAD54B [EC:5.6.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
Disease
H02418  Non-Hodgkin lymphoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    25788 (RAD54B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    25788 (RAD54B)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     25788 (RAD54B)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     25788 (RAD54B)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII HDA2-3 AAA_34
Other DBs
NCBI-GeneID: 25788
NCBI-ProteinID: NP_036547
OMIM: 604289
HGNC: 17228
Ensembl: ENSG00000197275
Pharos: Q9Y620(Tbio)
UniProt: Q9Y620
LinkDB
Position
8:complement(94371960..94475115)
AA seq 910 aa
MRRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINNTFLPSQNDL
RICSLNLPSEESTREINNRDNCSGKYCFEAPTLATLDPPHTVHSAPKEVAVSKEQEEKSD
SLVKYFSVVWCKPSKKKHKKWEGDAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEE
GQTLMICGKEIEVMGVISPDDFSSGRCFQLGGGSTAISHSSQVARKCFSNPFKSVCKPSS
KENRQNDFQNCKPRHDPYTPNSLVMPRPDKNHQWVFNKNCFPLVDVVIDPYLVYHLRPHQ
KEGIIFLYECVMGMRMNGRCGAILADEMGLGKTLQCISLIWTLQCQGPYGGKPVIKKTLI
VTPGSLVNNWKKEFQKWLGSERIKIFTVDQDHKVEEFIKSIFYSVLIISYEMLLRSLDQI
KNIKFDLLICDEGHRLKNSAIKTTTALISLSCEKRIILTGTPIQNDLQEFFALIDFVNPG
ILGSLSSYRKIYEEPIILSREPSASEEEKELGERRAAELTCLTGLFILRRTQEIINKYLP
PKIENVVFCRPGALQIELYRKLLNSQVVRFCLQGLLENSPHLICIGALKKLCNHPCLLFN
SIKEKECSSTCDKNEEKSLYKGLLSVFPADYNPLLFTEKESGKLQVLSKLLAVIHELRPT
EKVVLVSNYTQTLNILQEVCKRHGYAYTRLDGQTPISQRQQIVDGFNSQHSSFFIFLLSS
KAGGVGLNLIGGSHLILYDIDWNPATDIQAMSRVWRDGQKYPVHIYRLLTTGTIEEKIYQ
RQISKQGLCGAVVDLTKTSEHIQFSVEELKNLFTLHESSDCVTHDLLDCECTGEEVHTGD
SLEKFIVSRDCQLGPHHQKSNSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIF
QNITTQATGT
NT seq 2733 nt   +upstreamnt  +downstreamnt
atgagacgatctgcagcaccaagtcagttgcaggggaattccttcaaaaaaccaaaattt
atacctccaggaagaagtaatccaggtctgaatgaagagattacaaaactgaatccagat
ataaaattatttgagggtgttgcaattaataacacctttctcccgtcacaaaatgatctt
agaatatgcagtttaaatctgcctagtgaagaaagtactagagaaatcaataacagagat
aattgcagtggaaaatattgttttgaagcacctacactggcaacattagatccacctcat
acagttcattcggctcctaaagaagtagcagtgtccaaggaacaagaagagaaatctgat
agcctagttaaatatttcagtgttgtttggtgtaagccttcaaagaaaaaacataaaaag
tgggaaggtgatgctgttcttattgtaaaaggaaagtcatttatattaaagaatttggaa
ggcaaagacattggaagaggcattggttataaattcaaagagcttgaaaagattgaagag
ggccaaacactgatgatttgtggaaaagaaatagaagtcatgggtgtaatctctccagat
gacttcagcagtggcaggtgttttcagcttggaggaggaagtactgctatctcgcattct
tctcaggttgccaggaaatgtttctctaaccctttcaaaagtgtttgtaaaccaagttca
aaggaaaatagacagaatgatttccaaaattgcaaaccacgccatgacccatatacgcca
aattccctcgttatgccacgaccagataagaatcaccagtgggtattcaataagaactgt
ttccctcttgtggatgtagtgattgatccttaccttgtatatcatcttcgaccacatcag
aaagaaggaatcatattcctttatgaatgtgtaatgggaatgagaatgaatggcagatgt
ggagctattcttgctgatgaaatgggtttagggaagacattgcaatgtatttcgctcatc
tggaccctgcagtgtcagggaccctatggaggcaagccagtaataaagaagacactaatt
gtcacacctggaagcttggtgaataattggaagaaagaatttcaaaaatggctaggaagt
gaaaggatcaagatatttactgttgatcaggaccacaaagttgaagaattcatcaagtct
atattttattctgttcttattatcagttatgaaatgttacttcgttccctggatcaaatt
aagaatataaaatttgatcttctaatctgtgacgaggggcatcgtttgaagaacagtgcc
attaagacaactacagccctcattagcctttcttgtgagaaaagaataattctaactggt
actccaattcagaatgatctgcaagaattttttgcattaattgattttgtaaatccagga
atattaggctctttgtcatcttataggaaaatatatgaagaacccatcattttatcgaga
gaaccttctgcttctgaggaagaaaaggagttaggagaaagaagagcagctgaacttact
tgcctcactggactctttatccttagaagaacccaagaaattataaataaatatctccca
cctaaaatagagaatgttgtcttttgccgaccaggagcactacagattgagctttatcga
aagctgttaaattctcaggttgtcaggttctgccttcaagggttgttggaaaatagtccc
catctaatatgtataggagctcttaaaaaactgtgcaatcacccctgccttttgttcaac
tctataaaggaaaaggaatgtagctcaacttgtgataaaaatgaagaaaagagtctatac
aaaggcttgctaagtgtgtttcctgctgactacaaccctctcctgtttactgaaaaggag
tcaggaaaactacaggtgttgtccaagctcttagcggttatccacgaacttcgacctact
gaaaaggtggtgttggtatccaactatacacaaaccttgaacattttacaagaagtatgt
aagcgtcatggatatgcttatacaagacttgatggacaaacaccaatctctcaaaggcag
cagattgttgatggctttaacagtcaacactcttctttttttatttttttgttaagttca
aaagctggtggtgtaggacttaacctcattggaggatctcacttaattctctatgacatt
gattggaatccagccactgacattcaggcaatgtctagagtatggagagatggtcagaaa
tatcctgtacatatttacagactcctaactacaggtacaatagaagaaaagatctatcaa
aggcagatcagtaagcaaggtctttgtggggcagttgtcgacctcaccaagacatctgaa
catattcagttttcagtagaagaacttaaaaatttgttcacattacatgaaagttcagat
tgtgttactcatgatctgcttgactgtgagtgtacaggagaagaagttcatacaggtgat
tcgttggaaaaattcattgtctctagagattgtcagcttggtccacatcaccagaaatct
aactccctgaaacctctttctatgtcccagctgaagcaatggaaacatttttctggagat
catttaaatcttacagatccttttcttgaaagaataacagaaaatgtgtcattcattttt
cagaatataaccactcaagctactggcacatag

KEGG   Homo sapiens (human): 8438
Entry
8438              CDS       T01001                                 
Symbol
RAD54L, HR54, RAD54A, hHR54, hRAD54
Name
(RefSeq) RAD54 like
  KO
K10875  DNA repair and recombination protein RAD54 and RAD54-like protein [EC:5.6.2.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
Disease
H00031  Breast cancer
H02418  Non-Hodgkin lymphoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    8438 (RAD54L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    8438 (RAD54L)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     8438 (RAD54L)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     8438 (RAD54L)
SSDB
Motif
Pfam: SNF2-rel_dom Helicase_C ResIII DEAD HDA2-3 Rad54_N SWI2_SNF2
Other DBs
NCBI-GeneID: 8438
NCBI-ProteinID: NP_001136020
OMIM: 603615
HGNC: 9826
Ensembl: ENSG00000085999
Pharos: Q92698(Tbio)
UniProt: Q92698 A8K996
LinkDB
Position
1:46247688..46278473
AA seq 747 aa
MRRSLAPSQLAKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTN
QPPCLDSSQHEAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVL
YEPPPLSAHDQLKLDKEKLPVHVVVDPILSKVLRPHQREGVKFLWECVTSRRIPGSHGCI
MADEMGLGKTLQCITLMWTLLRQSPECKPEIDKAVVVSPSSLVKNWYNEVGKWLGGRIQP
LAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRLHVGVLQKGSVGLVICDEGHR
LKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELP
ILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQ
TELYKRFLRQAKPAEELLEGKMSVSSLSSITSLKKLCNHPALIYDKCVEEEDGFVGALDL
FPPGYSSKALEPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLY
VRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPAND
EQAMARVWRDGQKKTCYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGE
LKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVL
QAAWDAASTAITFVFHQRSHEEQRGLR
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgaggaggagcttggctcccagccagctggccaagagaaaacctgaaggcaggtcctgt
gatgatgaagactggcaacctggcctagtgactcctaggaaacggaaatccagcagtgag
acccagatccaggagtgtttcctgtctccttttcggaaacctttgagtcagctaaccaat
caaccaccttgtctggacagcagtcagcatgaagcatttattcgaagcattttgtcaaag
cctttcaaagtccccattccaaattatcaaggtcctctgggctctcgagcattgggcctg
aaaagggctggggtccgccgggccctccatgaccccctggaaaaagatgccttggttctg
tatgagcctcccccgctgagcgctcatgaccagctgaagcttgacaaggagaaactccct
gtccatgtggttgttgaccctattctcagtaaggttttgcggcctcatcagagagaggga
gtgaaattcctgtgggagtgtgtcaccagtcggcgcatccctggcagccatggctgcatc
atggctgatgagatgggcctaggaaagacgctgcagtgcatcacattgatgtggacactt
ttacgccagagtccagagtgcaagccagaaattgacaaggcagtggtggtgtcgccttcc
agcctggtgaagaactggtacaatgaggttgggaaatggctcggagggaggatccaacct
ctggccatcgatggaggatctaaggatgaaatagaccaaaagctggaaggattcatgaac
cagcgtggagccagggtgtcttctcccatcctcatcatttcctatgagaccttccgcctt
catgttggagtcctccagaaaggaagtgttggtctggtcatatgtgacgagggacacagg
ctcaagaactctgagaatcagacttaccaagccctggacagcttgaacaccagccggcgg
gtgctcatctccggaactcccatccagaatgatctgcttgagtatttcagcttggtacat
tttgttaattccggcatcctagggactgcccatgaattcaagaagcattttgaattgcca
attttgaagggtcgagacgctgctgctagtgaggcagacaggcagctaggagaggagcgg
ctgcgggagctcaccagcattgtgaatagatgcctgatacggaggacttctgatatcctt
tctaaatatctgcctgtgaagattgagcaggtcgtttgttgtaggctgacaccccttcag
actgagttatacaagaggtttctgagacaagccaaaccggcagaagaattgcttgagggc
aagatgagtgtgtcttccctttcttccatcacctcgctaaagaagctttgtaatcatcca
gctctaatctatgataagtgtgtggaagaggaggatggctttgtgggtgccttggacctc
ttccctcctggttacagctctaaggccctggagccccagctgtcaggtaagatgctggtc
ctggattatattctggcggtgacccgaagccgtagcagtgacaaagtagtgctggtgtcg
aattacacccagactttggatctctttgagaagctgtgccgtgcccgaaggtacttatac
gtccgcctggatggcacgatgtccattaagaagcgagccaaggttgtagaacgcttcaat
agtccatcgagccctgactttgtcttcatgctgagcagcaaagctgggggctgtggcctc
aatctcattggggctaaccggctggtcatgtttgaccctgactggaacccagccaatgat
gaacaagccatggcccgggtctggcgagatggtcaaaagaagacttgctatatctaccgc
ctgctgtctgcagggaccattgaggagaagatcttccagcgtcagagccacaagaaggca
ctgagcagctgtgtggtggatgaggagcaggatgtagagcgccacttctctctgggcgag
ttgaaggagctgtttatcctggatgaagctagcctcagtgacacacatgacaggttgcac
tgccgacgttgtgtcaacagccgtcagatccggccaccccctgatggttctgactgcact
tcagacctggcagggtggaaccactgcactgataagtgggggctccgggatgaggtactc
caggctgcctgggatgctgcctccactgccatcaccttcgtcttccaccagcgttctcat
gaggagcagcggggcctccgctga

DBGET integrated database retrieval system